KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3063Help
Entry
Maqu_3063         CDS       T00454                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Maqu_3063
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maqu_3063
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maqu_3063
Enzymes [BR:maq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Maqu_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3396395..3397753)
Genome map
AA seq 452 aa AA seqDB search
MQTKFLLDEEQMPRYWYNLQADFPEPLPAVLHPGTKQPVGPTDLEPLFPASLIEQEMTTE
REVEIPEPVRDVYRMWRPAPMFRAHRLEKALGTPAKIFYKYEGGSPAGSHKPNSAIPQAF
FNREAGIRRLTTETGAGQWGTSLSFAGSLFDIDVTVFQVRVSYNQKPYRRAVMETYGANC
VASPSEMTEFGRRVLGENPDHTGSLGIAISEAVELAVQDPHTKYALGSVLNHVLLHQTVI
GLESMKQMEMADCWPDVIVGCTGGGSNFAGVAFPFMGHALRGGEKSRIVAVEPSACPTLT
RGKYAYDYGDTAQMTPLTKMHTLGSGFTPPGFHAGGLRYHGMAPMVSHAKELGLFDAVSY
TQRECFEAGVLFARNEGIVPAPEANHAVKGAIDEALRCKREGKEEVILFNLCGHGHFDMA
AYTSYFAGELSDHEYGEQELAMALSGLPSVSV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccaagttcttgctcgacgaagaacaaatgcccaggtattggtacaacctgcag
gcggatttccccgaacccctgcctgccgttctccacccgggaacaaagcagccggtcggt
ccaacggatctggagccattgtttcctgcgtcgctgattgaacaggaaatgaccacggaa
cgggaagtggagattccggagcccgttcgcgatgtttatcgaatgtggcggccggcgccc
atgtttcgggcgcatcggctggaaaaagccctgggcaccccggccaagatcttctacaag
tacgagggtggcagtcctgcgggcagtcacaagcccaattccgcgattccgcaggccttt
ttcaaccgggaggccggtattcggcgtctgacgacagaaactggtgctggtcagtggggg
acctcgctgtcgtttgcaggctccctgttcgacattgatgtgaccgtgttccaggttcgc
gtgtcttacaaccagaagccctatcgccgtgcggtgatggagacctacggggctaactgc
gtggcttcaccatcagaaatgacagagtttggtcgtcgagtgctgggggaaaaccccgac
cacaccggcagtcttggtattgctatttccgaggcggtggagctggccgttcaggacccg
cacaccaaatatgctctgggttccgtgctgaaccatgtcctgttgcatcagaccgtaatc
ggcctggagtccatgaaacagatggagatggccgattgctggccagacgtgatcgttggg
tgcaccggtggcggctctaatttcgcgggtgttgcgttcccgttcatgggccatgcgttg
agaggcggggagaagtcccggattgtcgcggttgaaccctcagcatgtccgacgttgacc
cgaggtaaatacgcctatgactacggcgatacggcacaaatgacaccactcaccaagatg
cataccctgggttcgggttttacaccgccggggttccatgctggcggcctgcgctatcac
ggcatggctccgatggtgtcgcacgccaaggagctgggactgttcgatgctgtttcctac
actcagcgcgagtgctttgaggcgggtgtcctgtttgcgcgcaacgaagggattgtaccg
gcccctgaagccaatcatgccgtgaagggtgcgattgacgaggcgttgcggtgcaagcgc
gagggcaaggaggaggtgatcctgttcaacctttgtggtcacgggcatttcgatatggcg
gcctatacctcgtattttgccggtgaactgagcgaccatgagtacggcgagcaggagctg
gctatggcgttgtcggggctgccctcggtcagcgtctga

DBGET integrated database retrieval system