KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3327Help
Entry
Maqu_3327         CDS       T00454                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00010  Glycolysis / Gluconeogenesis
maq00020  Citrate cycle (TCA cycle)
maq00620  Pyruvate metabolism
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01200  Carbon metabolism
Module
maq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_3327
   00020 Citrate cycle (TCA cycle)
    Maqu_3327
   00620 Pyruvate metabolism
    Maqu_3327
Enzymes [BR:maq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Maqu_3327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABM20398
UniProt: A1U5X9
Position
complement(3676409..3678067)
Genome map
AA seq 552 aa AA seqDB search
MSEQEIKVPDLGGADEVEIIEIIVSEGDSVEEEDPILTVESDKASVELPAPAAGKITKIT
VKVGDKVKEGDVIGMLAASGDAGGSDDAGDDKSEQAEEKTEAPSEAKSEDTKSAPKKKKS
GGSRTEVVKVPSLDGFEDVPVIEINVAEGDTVGEEDPLVTVESDKATMEIPSPYAGKIGK
ILVKEGDKLSEGSDLLEMTIEDDGDDEDESADSGDSAQADSQESKPEKPQGKQESEPQPQ
GSTYEPPSPGTKVHAGPAVRKLARELGADLTRVKGSGPKGRIVKDDVHAYVKSQLQQSQQ
GSGVATGSGIPGVKLPDFSQFGEIEREGMSRMMAATATNMQRSWLNVPHVTQFDDADITE
MEAFRKGQKAAGEKRGVKMTPLPFLLKACAAALAELPQFNVSLDMERKEVVRKKYIHIGI
AVDTPHGLMVPVIRDVDQKGLWELAAESAELAQKARDKQLKPAEMQGACFTITSLGGIGG
TAFTPIVNTPEVAILGVSKASMKPVWDGKEFQPRLMLPLSLSYDHRAVNGADAARFTNLL
TQLLGDIRTLLL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggaaatcaaggttcccgatctcggcggtgctgatgaagtcgagatcatc
gaaatcatcgtcagtgaaggggattcggtagaggaagaagatccgattctgaccgtggaa
tccgacaaagcctcggtagaactgccggcccccgccgccggcaagatcaccaaaatcacc
gtcaaggtgggtgacaaggtgaaagagggcgacgtgatcggcatgctggccgccagcggt
gatgctgggggctcggacgatgccggggatgacaagtcggaacaggccgaggaaaaaacc
gaggcgccatctgaggccaaatcggaagacaccaagtcggctccgaaaaagaagaagtct
ggtggctctcgcaccgaagtggtgaaagtgccttcgctggatggctttgaagatgtgccg
gtgattgaaatcaacgtggctgaaggcgatacggttggcgaggaagacccgctggtaaca
gtggagtccgacaaggccaccatggaaattccatcgccctacgcgggcaagatcggcaag
attctggtgaaggaaggcgacaagctctccgaaggttcagacctcctggaaatgaccatc
gaagacgatggtgacgacgaggacgaatcggcagattccggtgacagcgcccaggcagac
agccaggaaagtaaaccggagaaaccccagggcaaacaggaatccgagcctcagccgcag
ggctctacctacgagccaccgtcacctggcaccaaggtgcacgccggtccggccgtgcgt
aaactggcccgggaactgggggcagacctcacgcgcgtgaaaggttcaggcccaaaaggc
cggatcgtgaaagacgatgtgcacgcctacgtgaagagccagttgcagcagtcccagcag
ggcagtggcgtagccactggctctggcattccgggcgtgaagctgccggacttcagccag
tttggtgagatcgagcgtgaaggcatgtcccgcatgatggcggccacggccaccaacatg
cagcgcagttggctgaacgtgccccacgtaacccagttcgacgatgccgacatcaccgaa
atggaagccttccgcaagggccagaaagcggccggcgaaaagcgtggcgtgaaaatgacc
ccgctgccgttcctgctcaaggcctgcgcggcggcactggcggaactgcctcagttcaac
gtgtccctggacatggagcgcaaagaggtggtgcgcaagaagtacatccacatcggcatt
gcggtggatacgcctcatggcctgatggttccggtgatccgggatgtcgaccagaaaggc
ctgtgggagctggcggcagaaagcgccgagctggcccagaaggcgagggacaagcagctg
aagccggcagaaatgcagggcgcctgctttaccatcaccagcctgggcggtattggtggc
accgcgttcacaccgattgtgaacacgccggaagtggcgatcctgggtgtctccaaggct
tctatgaagccggtgtgggacggcaaggagttccagccgcggctgatgcttccgctgtcg
ctgtcttacgaccaccgtgcggtgaacggggcagatgcggcccggtttaccaacctgctg
acgcagctgctgggggatattcggaccttgttgctgtag

DBGET integrated database retrieval system