KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3327Help
Entry
Maqu_3327         CDS       T00454                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maqu_3327
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_3327
   00020 Citrate cycle (TCA cycle)
    Maqu_3327
   00620 Pyruvate metabolism
    Maqu_3327
Enzymes [BR:maq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Maqu_3327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3676409..3678067)
Genome map
AA seq 552 aa AA seqDB search
MSEQEIKVPDLGGADEVEIIEIIVSEGDSVEEEDPILTVESDKASVELPAPAAGKITKIT
VKVGDKVKEGDVIGMLAASGDAGGSDDAGDDKSEQAEEKTEAPSEAKSEDTKSAPKKKKS
GGSRTEVVKVPSLDGFEDVPVIEINVAEGDTVGEEDPLVTVESDKATMEIPSPYAGKIGK
ILVKEGDKLSEGSDLLEMTIEDDGDDEDESADSGDSAQADSQESKPEKPQGKQESEPQPQ
GSTYEPPSPGTKVHAGPAVRKLARELGADLTRVKGSGPKGRIVKDDVHAYVKSQLQQSQQ
GSGVATGSGIPGVKLPDFSQFGEIEREGMSRMMAATATNMQRSWLNVPHVTQFDDADITE
MEAFRKGQKAAGEKRGVKMTPLPFLLKACAAALAELPQFNVSLDMERKEVVRKKYIHIGI
AVDTPHGLMVPVIRDVDQKGLWELAAESAELAQKARDKQLKPAEMQGACFTITSLGGIGG
TAFTPIVNTPEVAILGVSKASMKPVWDGKEFQPRLMLPLSLSYDHRAVNGADAARFTNLL
TQLLGDIRTLLL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggaaatcaaggttcccgatctcggcggtgctgatgaagtcgagatcatc
gaaatcatcgtcagtgaaggggattcggtagaggaagaagatccgattctgaccgtggaa
tccgacaaagcctcggtagaactgccggcccccgccgccggcaagatcaccaaaatcacc
gtcaaggtgggtgacaaggtgaaagagggcgacgtgatcggcatgctggccgccagcggt
gatgctgggggctcggacgatgccggggatgacaagtcggaacaggccgaggaaaaaacc
gaggcgccatctgaggccaaatcggaagacaccaagtcggctccgaaaaagaagaagtct
ggtggctctcgcaccgaagtggtgaaagtgccttcgctggatggctttgaagatgtgccg
gtgattgaaatcaacgtggctgaaggcgatacggttggcgaggaagacccgctggtaaca
gtggagtccgacaaggccaccatggaaattccatcgccctacgcgggcaagatcggcaag
attctggtgaaggaaggcgacaagctctccgaaggttcagacctcctggaaatgaccatc
gaagacgatggtgacgacgaggacgaatcggcagattccggtgacagcgcccaggcagac
agccaggaaagtaaaccggagaaaccccagggcaaacaggaatccgagcctcagccgcag
ggctctacctacgagccaccgtcacctggcaccaaggtgcacgccggtccggccgtgcgt
aaactggcccgggaactgggggcagacctcacgcgcgtgaaaggttcaggcccaaaaggc
cggatcgtgaaagacgatgtgcacgcctacgtgaagagccagttgcagcagtcccagcag
ggcagtggcgtagccactggctctggcattccgggcgtgaagctgccggacttcagccag
tttggtgagatcgagcgtgaaggcatgtcccgcatgatggcggccacggccaccaacatg
cagcgcagttggctgaacgtgccccacgtaacccagttcgacgatgccgacatcaccgaa
atggaagccttccgcaagggccagaaagcggccggcgaaaagcgtggcgtgaaaatgacc
ccgctgccgttcctgctcaaggcctgcgcggcggcactggcggaactgcctcagttcaac
gtgtccctggacatggagcgcaaagaggtggtgcgcaagaagtacatccacatcggcatt
gcggtggatacgcctcatggcctgatggttccggtgatccgggatgtcgaccagaaaggc
ctgtgggagctggcggcagaaagcgccgagctggcccagaaggcgagggacaagcagctg
aagccggcagaaatgcagggcgcctgctttaccatcaccagcctgggcggtattggtggc
accgcgttcacaccgattgtgaacacgccggaagtggcgatcctgggtgtctccaaggct
tctatgaagccggtgtgggacggcaaggagttccagccgcggctgatgcttccgctgtcg
ctgtcttacgaccaccgtgcggtgaacggggcagatgcggcccggtttaccaacctgctg
acgcagctgctgggggatattcggaccttgttgctgtag

DBGET integrated database retrieval system