KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3465Help
Entry
Maqu_3465         CDS       T00454                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maqu_3465
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Maqu_3465
Enzymes [BR:maq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Maqu_3465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3832008..3833600)
Genome map
AA seq 530 aa AA seqDB search
MPYAQDVDQIASILKQNPTWNAINPKHAARMRAQNKFKTGLDIAKYTAKIMREDMAAYDA
DSSKYTQSLGCWHGFIGQQKMISIKKHFGTTKRRYLYLSGWMVAALRSEFGPLPDQSMHE
KTSVSSLIEELYTFLRQADAWELNHLFRALEEAENAGDTAKAEELIKQIDNHETHVVPII
ADIDAGFGNAEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKINA
VRLAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDQYNSFLDGEYIDDASQIEN
GDVVIKSNGKLLKPKRLASGLFCFKPGSGEDRVVLDCITSLQNGADMLWIETEKPHVGQI
AGMVNRIKEVVPDAKLVYNNSPSFNWTLNFRQQVFDAWKEEGKDVSAYDRANLMSAEYDN
TELGQLADEWCRNFQRDASREAGVFHHLITLPTYHTVALSTDNLAKGYFGDEGMLAYVAG
VQRQEIRQGIATVKHQDMAGSNIGDDHKEFFAGEAALKAGGKDNTMNQFG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgcacaagacgtcgaccaaatcgcttccatcctgaagcagaacccgacctgg
aacgccatcaacccgaagcacgcagcccgcatgcgcgcccagaacaaattcaagactggt
ctggacatcgccaagtacaccgccaagatcatgcgtgaagacatggctgcttacgatgcc
gattcttccaagtacacccagtccctgggttgctggcacggtttcatcggccagcagaag
atgatctccatcaagaagcacttcggtaccaccaagcgtcgttacctgtacctgtctggc
tggatggttgccgccctgcgttccgagttcggcccgctgcctgaccagtccatgcacgag
aagacttccgtttctagcttgatcgaagagctgtataccttcctgcgtcaggccgatgcc
tgggaactgaaccacctgttccgcgctctggaagaagctgaaaacgctggcgacaccgcc
aaggctgaagagctgatcaagcagatcgataaccacgaaacccacgttgtaccgatcatt
gctgacatcgacgctggtttcggtaacgccgaagcgacctacctgctggccaagaagatg
atcgaagccggtgcttgctgtatccagatcgaaaaccaggtatctgacgagaagcagtgt
ggccatcaggacggtaaggtaactgttccccacgccgacttcctggcgaagatcaacgcg
gttcgcctggcgttcctggaactgggtgtggacgacggtgtgatcgttgcccgtactgac
tctctgggtgctggcctgaccaagcagatcgctgttaccaacgagccgggcgacctgggc
gaccagtacaacagcttcctggacggcgagtacatcgacgacgcttcccagatcgagaac
ggcgacgttgtgatcaagtccaacggcaagctgctgaagccgaagcgcctggcctctggc
ttgttctgcttcaagccgggttctggcgaagaccgtgttgttctggactgcatcaccagc
ctgcagaacggcgcagacatgctgtggatcgaaaccgagaagccgcacgttggccagatt
gcgggcatggttaaccgcatcaaggaagtggtgccggatgccaagctggtttacaacaac
agcccgtccttcaactggaccctgaacttccgtcagcaggtattcgacgcgtggaaggaa
gaaggcaaggacgtatctgcctacgaccgcgccaacctgatgagcgccgagtacgacaac
actgagctgggccagctggctgacgagtggtgccgtaacttccagcgtgatgcgtcccgt
gaagccggtgtattccaccacctgatcactctgccgacgtaccacactgtggctctgtct
accgacaacttggccaagggctacttcggtgacgaaggcatgctggcctacgttgctggc
gtacagcgtcaggaaatccgtcagggcatcgctactgtgaagcaccaggacatggccggt
tccaacatcggtgatgaccacaaagagttcttcgctggtgaagcggccctgaaggccggt
ggtaaagacaacaccatgaaccagttcggttaa

DBGET integrated database retrieval system