KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3561Help
Entry
Maqu_3561         CDS       T00454                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00010  Glycolysis / Gluconeogenesis
maq00030  Pentose phosphate pathway
maq00051  Fructose and mannose metabolism
maq00052  Galactose metabolism
maq00230  Purine metabolism
maq00500  Starch and sucrose metabolism
maq00520  Amino sugar and nucleotide sugar metabolism
maq00521  Streptomycin biosynthesis
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_3561
   00030 Pentose phosphate pathway
    Maqu_3561
   00051 Fructose and mannose metabolism
    Maqu_3561
   00052 Galactose metabolism
    Maqu_3561
   00500 Starch and sucrose metabolism
    Maqu_3561
   00520 Amino sugar and nucleotide sugar metabolism
    Maqu_3561
  Nucleotide metabolism
   00230 Purine metabolism
    Maqu_3561
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Maqu_3561
Enzymes [BR:maq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Maqu_3561
    5.4.2.8  phosphomannomutase
     Maqu_3561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Sensor DUF2218
Motif
Other DBs
NCBI-ProteinID: ABM20630
UniProt: A1U6L1
Position
complement(3937303..3939948)
Genome map
AA seq 881 aa AA seqDB search
MKFAKKKTNASSGDEQPEKKPGKKQKPSKASKEAAGSGLKKLGSVGLNQSLVVLVAGVVA
VVLAHFLVVVPAGEARYEAASAMEVDSAQRRLNQSLTALQEQVRAVANQRYAALALAERS
DLANLAEQLQAALPGSAQVFVFPYREVPRTGNGDTLLGFAGLELARRAENGQNLLPDAFP
RDNQWYLQFAAAVRHPTSNAVVGSVLAVFEASHIQPLLAVSNSQLGGKLSLVQSVSGASR
TVASVGNGSGPELSRTLINPDWSVSYQPASAPVAPVSTILLAILVGVPALVAAVLVWVLL
GNAQRGIRQDVTALIQWAHKVFGGERMKLPALRWDMVASTGEVLFRLSQMVEKRVAKAAE
SAAPKAAPARRKAATAEDEPLFQDKDMPDIDMLDGDEDVLGFGGSEDSLFDEDIPEVAEA
EVPAVQINPEIFRAYDIRGIVGQTLSAEVVEVIGRAIGSEATERGVTDICIGYDGRHSSP
ELADALGRGIMATGCNIIHLGAIPTPVLYFATHHLQTGSGVMVTGSHNPANYNGLKIMLG
GETLSGEAIQKLYQRIQTADLARGQGEQSRDDVRRAYLDRIVGDIAVAAPLKVVVDAGNG
IAGELGPMLVEELGCEVTPLYCEVDGDFPNHHPDPGKPANLQDLIAKVKETGADIGLAFD
GDGDRLGVVTNTGKIIWPDRLLMLFARDVVSRNPGADVLYDVKCSRRLASVISEAGGRPI
MWKTGHSLMKAKMKETGALLAGEMSGHIFFGERWYGFDDGLYSAARLLEILGIEDRHSDE
VFEDFPEDISTPELNVEVTESDKFAIIERLGQQADFGDGNTSTIDGIRVDYADGWGLCRA
SNTTPVLVLRFEAETEQALERIKSVFREQLQKAAPDLVAEF
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgccaagaaaaaaaccaacgcgtcttccggtgatgagcagccggagaagaag
cccggaaagaaacagaaaccgtccaaagcgtccaaagaagcggctggctccgggctaaag
aaactcggatcggtcgggctgaatcaatcactggtggtgctggtggccggcgtggtcgcg
gtggtgctggcgcattttctggtggtggtgcccgccggggaagcccgttatgaggcggcc
agtgccatggaggtggacagtgcccagcggcgcctgaatcagtcactgacggcgctgcag
gaacaggttcgggcggtggccaaccagcgctacgccgcccttgctctggcggagcgctcc
gatctggcgaatctggctgagcaactgcaagcagcgctgcccggctccgcccaggtgttt
gtcttcccgtatcgggaagttccccggaccggtaacggcgataccctgctgggatttgcg
ggcctggaactggcccggcgggcagaaaatggacagaacctgttgccggacgccttcccc
cgggacaatcagtggtatctgcaatttgccgcggcggtacgtcaccccaccagcaatgcc
gtggttggtagcgtactggcggtctttgaggcgtcccatattcagccattgctggctgtg
agcaattcgcaacttggtggcaagttgtcactggtccaatccgtatccggtgcttcacga
accgtggccagcgtcggtaatggcagcggcccggagctgtcccgcactttgatcaatccg
gactggtccgtcagttatcaacccgcttcggcgccggtggcgccggtcagcaccatcctc
ctggcgattctggtgggggtgccggcgctggtggcggcggttctggtctgggtgcttctc
ggtaatgcccagcgtggtattcgccaggatgtgaccgcgctcattcagtgggcccacaag
gtgttcggaggcgagcggatgaaactgccggctctgcgctgggatatggtggcgtccacc
ggagaagtgctgttccgtctgtcgcagatggttgagaagcgggtggccaaggccgcggag
tcggctgcgcccaaagcggctcctgcccgccgcaaggcagcgacggcggaggatgaaccg
ctgtttcaggacaaggacatgccggacattgacatgctcgatggtgacgaggatgtgctc
ggctttggtggctccgaggattccctgttcgacgaggacattcctgaagttgctgaggcc
gaggtgcctgcggttcagatcaacccggaaatcttccgcgcctatgacatccggggcatc
gtcggtcagaccctttcggcagaggtggttgaagtcattggtcgcgcgatcggctcggaa
gcgaccgagcgtggtgtcacagatatctgtattggctacgatggccggcactccagtccg
gaattggctgatgccctggggcgcggcatcatggcgaccggttgtaacatcattcacctg
ggggccatacctacgccggtgctgtactttgcaacccatcacctgcagaccggttctggc
gttatggtgaccggtagccataatccagccaactataacggcctgaagatcatgctgggc
ggagagaccctgtctggtgaagctatccagaagctgtaccagcgcatccagaccgccgac
cttgccagagggcagggtgagcaatcccgggacgacgtacgccgcgcctatctggaccgt
atcgtcggtgatattgctgtggcggcgccgttgaaagtggtggtcgatgccggtaacggc
attgccggagagctgggccccatgctggttgaggagctgggctgtgaagtcacgccactg
tattgtgaagtggacggtgatttcccgaatcatcacccggaccccggcaaacccgcgaac
ctgcaggacctgattgccaaggttaaggagaccggcgccgatatcgggctggcctttgat
ggcgatggtgatcgtctgggcgtggttaccaataccggcaagatcatctggccggatcgc
ctgctgatgctctttgccagggatgtggtgtcccgcaatcccggcgcggatgtgctctat
gacgtgaagtgcagccgccggctggccagcgtgatctcggaagctggagggcgcccgatc
atgtggaaaaccggccattccctgatgaaagcgaaaatgaaggaaaccggcgccctgctg
gcgggcgaaatgagcggacacattttcttcggcgaacgctggtacggctttgacgatggc
ctttactcggctgcccggctgctggaaatcctgggcattgaggatcgtcactccgatgaa
gtctttgaagacttccccgaggatatcagtacccctgagctgaatgtcgaggtgaccgag
agcgacaagttcgccatcattgaacggctaggtcagcaggcggattttggtgacggcaat
accagtaccatcgatggcattcgggtagattatgccgatggctgggggctatgccgtgcg
tccaataccacgccggttctggttctgcgctttgaagccgaaacagaacaggcactggag
cggatcaaatccgtgttccgggagcaactgcagaaagcggcaccagacctggtggcggaa
ttctga

DBGET integrated database retrieval system