KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3782Help
Entry
Maqu_3782         CDS       T00454                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Maqu_3782
Enzymes [BR:maq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Maqu_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4196419..4196988
Genome map
AA seq 189 aa AA seqDB search
MSLPLDDLADHYRTIIQGLGEDPDREGLQNTPMRAAKAMQFLTRGYQQDLEELVNNAVFE
SAMDEMVVIQDIELYSMCEHHMLPFIGKCHIAYLPQGKVLGLSKFARIVDMYARRLQIQE
NLTRQIAEAIESVTQAKGVAVVIEAQHMCMMMRGVEKQNSRMKTSMMLGQFRKSQATRTE
FLNLISSNR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaccccttgatgatctggccgatcactaccgcactattatccagggcctgggc
gaagacccggatcgagaaggcctccagaacacgcccatgcgtgcagccaaggccatgcag
ttcctcacacgcggctaccagcaggaccttgaagagctggtcaataacgccgtgtttgaa
tccgccatggacgaaatggtggtgattcaggacatcgaactgtacagcatgtgcgagcat
catatgctgcccttcatcggcaagtgccacatcgcctatttgccccagggcaaggtgctg
ggcttgtccaagtttgcccgcatcgtcgacatgtatgcccgccggttacagattcaggaa
aacctcacccgtcagatcgccgaagccatcgagagcgttacccaggccaagggcgtcgcg
gtggtcattgaagcccagcacatgtgcatgatgatgcgcggcgtggagaagcagaactcg
cgtatgaaaacctccatgatgctcgggcagttccgcaaatcccaggcaacccggaccgaa
ttcctgaacctgatttccagtaaccgctga

DBGET integrated database retrieval system