KEGG   Methylobacterium aquaticum: Maq22A_1p37465Help
Entry
Maq22A_1p37465    CDS       T04311                                 

Gene name
phaA
Definition
(GenBank) acetyl-CoA acetyltransferase/Beta-ketothiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maqu  Methylobacterium aquaticum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:maqu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Maq22A_1p37465 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    Maq22A_1p37465 (phaA)
   00640 Propanoate metabolism
    Maq22A_1p37465 (phaA)
   00650 Butanoate metabolism
    Maq22A_1p37465 (phaA)
  Lipid metabolism
   00071 Fatty acid degradation
    Maq22A_1p37465 (phaA)
   00072 Synthesis and degradation of ketone bodies
    Maq22A_1p37465 (phaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Maq22A_1p37465 (phaA)
   00310 Lysine degradation
    Maq22A_1p37465 (phaA)
   00380 Tryptophan metabolism
    Maq22A_1p37465 (phaA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Maq22A_1p37465 (phaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Maq22A_1p37465 (phaA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Maq22A_1p37465 (phaA)
Enzymes [BR:maqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Maq22A_1p37465 (phaA)
Exosome [BR:maqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Maq22A_1p37465 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pMaq22A_1p:1408252..1409433
Genome map
AA seq 393 aa AA seqDB search
MAEKADIVIVGAARTPVGSFNGAFATVPAHKLGAVAIKAALERAKVSPEEVDEVIFGQVL
AAGEGQNPARQAAMAAGIPQEKTAWGLNQLCGSGLRTVAVGMQQIANGDADIIVAGGQES
MSMAPHAQYLRGGQKMGDLKLVDTMLKDGLMDAFNGYHMGNTAENIAQQWQLTREEQDAF
AARSQNKAEAAKKDGRFKDEIAPVTVPGRKGDVVVDTDEYIRDGATPEGMAKLKPAFSKD
GTVTAGNASGINDGAAALVLMSAAEAEKRGLKPLARIASWATAGVDPKIMGTGPIPASRK
ALEKAGWKASDLDLIEANEAFAAQALAVNKDLGFDDAKVNVNGGAIAIGHPIGASGARVL
VTLLHEMQRRDAKKGLATLCIGGGMGVAMCLER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaggcagatatcgtcatcgtgggtgcggcccgcaccccggtcggctcgttc
aacggggccttcgccaccgtcccggcccacaagctcggcgcggtcgccatcaaggcggcg
ctcgagcgcgccaaggtctcccccgaggaggtcgacgaggtgatcttcggccaggtgctc
gccgcgggcgagggccagaacccggcccgccaggccgccatggccgccggcatcccgcag
gagaagaccgcctggggcctcaaccagctctgcggctcggggctgcgcaccgtcgcggtc
ggcatgcagcagatcgccaacggcgacgccgacatcatcgtggccggcggccaggaatcg
atgtcgatggccccccacgcccagtacctgcgcggcggccagaagatgggcgacctcaag
ctcgtcgacacgatgctgaaggacggcctgatggacgccttcaacggctaccacatgggc
aacaccgccgagaacatcgcccagcagtggcagctgacccgcgaggagcaggacgccttc
gcggcccgctcgcagaacaaggccgaggccgccaagaaggacggccgcttcaaggacgag
atcgcccccgtcaccgtgcccggccgcaagggcgacgtggtggtcgacaccgacgagtac
atccgcgacggcgcgacccccgaggggatggccaagctgaagcccgccttctcgaaggac
ggcacggtcaccgccggcaacgcgtcgggcatcaacgacggcgccgccgccctggtgctg
atgtcggcggcggaggccgagaagcgcggcctcaagccgctcgcccgcatcgcctcctgg
gccaccgccggcgtcgacccgaagatcatgggcaccggcccgatcccggcctcgcgcaag
gccctggagaaggccggctggaaggcctccgacctcgacctgatcgaggcgaacgaggcc
ttcgccgcccaggcgctcgcggtcaacaaggacctgggcttcgacgatgcgaaggtcaac
gtgaacggcggcgccatcgccatcggccacccgatcggcgcgtcgggcgcccgcgtcctc
gtcacgctgctgcacgagatgcagcgccgcgacgccaagaagggcctcgccacgctctgc
atcggcggcggcatgggcgtcgccatgtgcctcgagcgctga

DBGET integrated database retrieval system