KEGG   Microcystis aeruginosa: MAE_08410Help
Entry
MAE_08410         CDS       T00647                                 

Definition
glycosidase-like protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mar  Microcystis aeruginosa
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MAE_08410
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MAE_08410
Enzymes [BR:mar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MAE_08410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
736293..738647
Genome map
AA seq 784 aa AA seqDB search
MLNLVSLPEIPAAAWKRPLGKGWEKPYSVRYASNLDDGPWHGMPLGGFGAGCIGRSPKGD
FNLWHLDGGEHSFNSLAACQFSIFEQTEDGSAQAYAMATESPTDGTLSRWSWYPAEKGTY
SALYPRSWYEYKDVFQTQLICEQFSPVWAHNYQESSYPIALFEWTAHNPTDKPITISIML
TWQNTIGWFTNGIKSPVVKVRDDGSPVYEYQSKWGESEGNYNQWIVDNFRVGCLMRRDYE
NPGEGDGQMAIATITNPSLEVFYLGKWNPAGDGGEVWDYFAMNGSLPDIEDETPAQKGEQ
TATAMAIRFTIRPGKTRKIPFILAWDLPVNEFAQGINYYRRYTDFFGRNGQNAWAMVRTA
LKHGDTWRENIINWQKPILERSDLADWFKMALFNELYLLTDGGTLWTAATERDPIGQFGV
LECIDYRWYESLDVRLYGSFGLLMLWPRLEKAVMEAFARAIPSSDDTPRIIGYNQASAIR
KTKNATPHDLGAPNEHPWQKSNYTSYQDCNLWKDLGSDFVLLVYRDYLLTGAKDEDFLRE
CWPSIVLTLQYLKTFDLDKDGIPENSGAPDQTFDDWRLQGISAYCGGLWIAALEATLKIG
AILGEDTEIFASWLQQSRAIYHQTLWNGEYYNLDSGSGSDVVMTDQLCGQFYSRLLALPD
VVENQYTQSALSKIYQACFLKFHGGKFGAANGLKPDGTPENPQATHPLEVWVGINFGLVA
FLMQMGMEKQGWQITEAVVKQVYENGLQFRTPEAITSVGTFRACHYLRAMAIWAIYGVLT
EFQG
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatctcgtctcccttccagaaattcccgccgccgcttggaaacgtcctctgggc
aaaggttgggaaaaaccctacagcgtccgctatgccagcaatttagatgatggtccttgg
catgggatgcctctggggggatttggggccggttgcatcggacgttcccccaaaggtgac
tttaacctctggcatctggacggcggtgaacacagctttaatagccttgcagcctgtcaa
tttagcatttttgaacaaacagaagacggaagcgcccaagcctacgctatggcgacggaa
agcccgacggatggaacattatcgcgctggtcgtggtatccagccgaaaaggggacatat
tctgcgctttatccccgcagttggtacgagtataaagatgtttttcagactcaattaatt
tgcgaacaattctcaccagtttgggcgcataattatcaagaaagtagttatcctattgcc
ctatttgaatggacggcccataatcccaccgataaaccgattactattagtattatgctg
acttggcaaaatacaatcggttggtttactaacgggattaaatccccagtggttaaggtg
agagatgatggtagtcccgtttatgaatatcaatcaaaatggggagaaagtgagggtaat
tataatcaatggattgtcgataatttccgcgttggctgtctaatgcgtcgagattacgaa
aaccccggggaaggggatggacagatggcgattgccactatcactaatccgagtctagag
gtattctatctgggtaaatggaaccctgctggcgatgggggcgaagtttgggattatttc
gccatgaatggctctttaccggatattgaggacgaaacccccgcccaaaaaggggaacaa
acggccacggccatggcgattcgttttaccattcgtccggggaaaactcgcaaaattccc
tttattttagcttgggatttacccgttaacgaatttgcccaaggaattaactattatcgt
cgttatacggactttttcggtcgcaatggtcaaaatgcttgggcgatggtacgcacggct
ttaaaacacggcgatacatggcgagaaaatattattaactggcaaaaaccgatcctagaa
cgcagcgatctggccgattggtttaaaatggctttatttaacgaattatacctgttaacg
gacggcggcactctctggacggccgccacggaacgggatccgattggtcaattcggagtg
ttagaatgtattgattatcgttggtatgaaagtcttgatgtgcgtctctatggttccttt
gggttattgatgttatggccgcgcttagaaaaggccgtcatggaagcttttgctagggca
attcccagcagtgacgacactcctcggattattggatataaccaagctagtgccattcgt
aagaccaaaaatgccactccccacgatttaggcgcacccaatgaacacccttggcaaaag
agcaattacaccagttatcaagattgtaatctctggaaagatttaggcagtgattttgtt
ttattagtctatcgggattatttattaacgggggctaaagatgaggattttctgcgggaa
tgttggccgtcaattgtcctgactttgcaatatttaaaaacttttgaccttgataaggat
gggattcccgaaaattccggcgcaccagaccaaacctttgatgattggcgtttacaggga
attagtgcctattgtggtggtttgtggatagcggcactagaagcgacgcttaaaattggg
gcaattcttggggaagatacagaaatttttgccagttggttacagcaatctcgcgctatt
tatcatcagactctctggaatggagaatattataatttagatagtggcagtggttccgat
gtggtgatgactgatcaattatgtggtcaattttattcccgtttattggctttaccagat
gtggtagaaaatcaatacacgcaatcagctttaagtaagatttatcaggcttgttttctc
aagtttcatgggggaaaatttggggcggcaaatgggttaaaacccgatggtactcccgaa
aatccccaggcaactcatcccttggaagtttgggtaggaattaattttgggttggtggct
tttttgatgcaaatgggaatggaaaagcaaggatggcaaattacagaagcggtggtgaaa
caagtctatgaaaatggcttacaatttcgcactccagaagcgattacatcggtgggaact
ttccgcgcctgtcattatttacgcgccatggctatctgggctatctatggggttttgacg
gaatttcagggataa

DBGET integrated database retrieval system