KEGG   Microcystis aeruginosa: MAE_11290Help
Entry
MAE_11290         CDS       T00647                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mar  Microcystis aeruginosa
Pathway
mar00010  Glycolysis / Gluconeogenesis
mar00051  Fructose and mannose metabolism
mar00562  Inositol phosphate metabolism
mar00710  Carbon fixation in photosynthetic organisms
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
mar01120  Microbial metabolism in diverse environments
mar01130  Biosynthesis of antibiotics
mar01200  Carbon metabolism
mar01230  Biosynthesis of amino acids
Module
mar_M00002  Glycolysis, core module involving three-carbon compounds
mar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_11290 (tpi)
   00051 Fructose and mannose metabolism
    MAE_11290 (tpi)
   00562 Inositol phosphate metabolism
    MAE_11290 (tpi)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MAE_11290 (tpi)
Enzymes [BR:mar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MAE_11290 (tpi)
Exosome [BR:mar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MAE_11290 (tpi)
  Exosomal proteins of bladder cancer cells
   MAE_11290 (tpi)
  Exosomal proteins of melanoma cells
   MAE_11290 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAG00951
CYORF: MAE_11290
UniProt: B0JSQ7
Position
980331..981023
Genome map
AA seq 230 aa AA seqDB search
MHKTQREALEFLQDFKSHLEETPDDREVVLCAPFTALAVLSKTLHGGRIRLGAQNVHWEK
SGAYTGEISADMLTEIGVHYVVIGHSERRQYFGETDETVNLRVISAQKQGLIPIICVGES
KAQRDAGETEKVIIKQIQAGLVNVDQKNLVIAYEPIWAIGTGETCESEEANRVIGLIRQQ
LDNPEVTIQYGGSVKPDNIDEIMAQSQINGALVGGASLDPAVFARIVNYR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacccagagagaagctttggagtttttgcaagattttaaatcccatctagag
gaaacccccgacgaccgagaagtagttctttgcgcgcctttcacagctttagctgtcctc
tctaaaaccctccacggtggtcgtattcgcttgggggcgcaaaatgtccactgggaaaaa
tcgggggcttatacgggggaaatttcggcggatatgttaaccgaaatcggggttcactat
gtggttatcggtcacagtgaacgccgtcaatatttcggcgaaaccgatgaaaccgtcaat
ttaagggtcatatctgcccaaaaacaaggtttaatcccgattatctgcgtgggagaaagt
aaagcccaaagagatgccggagaaacggaaaaggtaattatcaagcaaattcaagcaggt
ttagtcaatgttgaccaaaaaaacctcgttatcgcctacgaacccatttgggcgattggc
acgggggaaacctgcgaaagcgaggaagctaatcgagttatcggtttgattcggcaacaa
ttagacaatcccgaagtaaccattcagtacggtggttcggtaaaacccgataatatcgat
gaaattatggcccaatcgcagataaacggggctttagtcggtggggcgagtctagacccc
gccgtattcgccagaattgttaattatcgttaa

DBGET integrated database retrieval system