KEGG   Microcystis aeruginosa: MAE_11290Help
Entry
MAE_11290         CDS       T00647                                 

Gene name
tpi
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mar  Microcystis aeruginosa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mar01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mar01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mar00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mar00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mar00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:mar00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
980331..981023
Genome map
AA seq 230 aa AA seqDB search
MHKTQREALEFLQDFKSHLEETPDDREVVLCAPFTALAVLSKTLHGGRIRLGAQNVHWEK
SGAYTGEISADMLTEIGVHYVVIGHSERRQYFGETDETVNLRVISAQKQGLIPIICVGES
KAQRDAGETEKVIIKQIQAGLVNVDQKNLVIAYEPIWAIGTGETCESEEANRVIGLIRQQ
LDNPEVTIQYGGSVKPDNIDEIMAQSQINGALVGGASLDPAVFARIVNYR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacccagagagaagctttggagtttttgcaagattttaaatcccatctagag
gaaacccccgacgaccgagaagtagttctttgcgcgcctttcacagctttagctgtcctc
tctaaaaccctccacggtggtcgtattcgcttgggggcgcaaaatgtccactgggaaaaa
tcgggggcttatacgggggaaatttcggcggatatgttaaccgaaatcggggttcactat
gtggttatcggtcacagtgaacgccgtcaatatttcggcgaaaccgatgaaaccgtcaat
ttaagggtcatatctgcccaaaaacaaggtttaatcccgattatctgcgtgggagaaagt
aaagcccaaagagatgccggagaaacggaaaaggtaattatcaagcaaattcaagcaggt
ttagtcaatgttgaccaaaaaaacctcgttatcgcctacgaacccatttgggcgattggc
acgggggaaacctgcgaaagcgaggaagctaatcgagttatcggtttgattcggcaacaa
ttagacaatcccgaagtaaccattcagtacggtggttcggtaaaacccgataatatcgat
gaaattatggcccaatcgcagataaacggggctttagtcggtggggcgagtctagacccc
gccgtattcgccagaattgttaattatcgttaa

DBGET integrated database retrieval system