KEGG   Microcystis aeruginosa: MAE_11850Help
Entry
MAE_11850         CDS       T00647                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mar  Microcystis aeruginosa
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mar00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1034460..1035014
Genome map
AA seq 184 aa AA seqDB search
MQPGQLIVITGPSGVGKGTLVRHLLTRFPNLYLSVSATTRPPRPGEIEGEDYYFLDRPSF
EEKMAAGEFLESAEYAGNYYGTPQSAIAAQLATGQTVILEIELEGARQVCQSFPEARRIF
ILPPSFEELERRLRGRGKDAETAIARRLERAQEELAASEEFPDQIVNDDLETALDAIEKI
IFSR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccggtcaattaattgtcattaccggccctagcggtgtgggcaagggtacgcta
gtccggcatttactaactcgtttccctaacctctacctgtccgtatccgccactacgcgc
ccacctcgaccgggtgaaattgagggggaagattactactttctcgaccgtcccagtttc
gaggagaaaatggcagccggagaatttctagaatcggccgaatacgcgggcaactactat
gggacaccccaatcagcgatcgccgctcaattagcaacaggccagaccgtaattctagaa
atcgaattggagggagccagacaggtctgtcaaagcttccccgaagcgaggagaatcttt
atcctaccccccagtttcgaggaattagaacgtcgtttgcgcggccggggcaaagatgcc
gaaacagcgatcgcccgccgtctagagcgcgcccaagaagaattagccgccagcgaggaa
ttccccgatcaaatcgtcaacgatgacctagaaaccgccctagatgccatcgagaagatt
atttttagccgttag

DBGET integrated database retrieval system