KEGG   Microcystis aeruginosa: MAE_11850Help
Entry
MAE_11850         CDS       T00647                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mar  Microcystis aeruginosa
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MAE_11850 (gmk)
Enzymes [BR:mar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MAE_11850 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1034460..1035014
Genome map
AA seq 184 aa AA seqDB search
MQPGQLIVITGPSGVGKGTLVRHLLTRFPNLYLSVSATTRPPRPGEIEGEDYYFLDRPSF
EEKMAAGEFLESAEYAGNYYGTPQSAIAAQLATGQTVILEIELEGARQVCQSFPEARRIF
ILPPSFEELERRLRGRGKDAETAIARRLERAQEELAASEEFPDQIVNDDLETALDAIEKI
IFSR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccggtcaattaattgtcattaccggccctagcggtgtgggcaagggtacgcta
gtccggcatttactaactcgtttccctaacctctacctgtccgtatccgccactacgcgc
ccacctcgaccgggtgaaattgagggggaagattactactttctcgaccgtcccagtttc
gaggagaaaatggcagccggagaatttctagaatcggccgaatacgcgggcaactactat
gggacaccccaatcagcgatcgccgctcaattagcaacaggccagaccgtaattctagaa
atcgaattggagggagccagacaggtctgtcaaagcttccccgaagcgaggagaatcttt
atcctaccccccagtttcgaggaattagaacgtcgtttgcgcggccggggcaaagatgcc
gaaacagcgatcgcccgccgtctagagcgcgcccaagaagaattagccgccagcgaggaa
ttccccgatcaaatcgtcaacgatgacctagaaaccgccctagatgccatcgagaagatt
atttttagccgttag

DBGET integrated database retrieval system