KEGG   Microcystis aeruginosa: MAE_12590Help
Entry
MAE_12590         CDS       T00647                                 

Definition
ammonium transport protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mar  Microcystis aeruginosa
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MAE_12590
Enzymes [BR:mar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MAE_12590
Transfer RNA biogenesis [BR:mar03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MAE_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1114959..1115834
Genome map
AA seq 291 aa AA seqDB search
MINLTCQDNETLDRILAVTRAVGWGGAKILQSYYRGEQDLAVNKKKKGGPVTAADLAANN
YILGELQTNFSDIDFGYLSEETHQGNEAIPKDWVWIIDPLDGTRDFINKTGEYALHIALC
YQGRPLIAVVALPDQEKLYFAQKGKGTFLETSDGNITQVKVANKDKITELYLVVSRTHRD
QRFDNLLSQIPFFGKNYVASVGCKIATILEQKSDVYISLSGKSAAKDWDFAAPELILTEA
GGKFSYFDGQPVRYNRGDVRQWGGIMASNGPCHQQLCQLSTAILAQIDATV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttaacctgtcaagataacgaaacgctcgatcgcattttagctgtgactcgt
gccgtcggttggggtggtgctaaaattcttcaatcctactaccggggtgaacaggattta
gccgtcaacaagaagaaaaaaggcggaccagtgacggcggcggatttagcggcaaataac
tatattttaggggaattacaaacaaatttctcggatatcgactttggttatctgagcgag
gaaacccatcaaggcaatgaagctatcccgaaagattgggtatggattatcgatcctttg
gacggaacccgcgattttatcaacaaaacgggagaatatgccctacatatcgccttatgt
tatcagggaagaccgctcatcgccgtggttgccctaccggatcaagaaaaactctatttt
gcccaaaaaggaaaaggtacttttctagaaactagcgacggaaatattacacaggtaaaa
gttgccaataaagataaaattaccgagctctatctggtggttagtcgtacccatcgcgac
caacgttttgataatttattaagtcaaatacccttcttcggtaaaaattatgtggctagt
gtgggctgtaaaattgccacgatcctcgaacaaaaatccgatgtttatatctccctatcg
gggaaatcggcggctaaagactgggattttgccgctccggagttgattttaacggaagcc
ggcggcaaattttcctattttgacggtcaacccgtgcgctataatcgcggcgatgtgcgg
caatggggggggatcatggctagtaatggtccttgtcatcaacaactttgtcagttgtcc
acggcaatcctcgcccaaattgatgccactgtctaa

DBGET integrated database retrieval system