KEGG   Microcystis aeruginosa: MAE_12590Help
Entry
MAE_12590         CDS       T00647                                 

Definition
ammonium transport protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mar  Microcystis aeruginosa
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mar00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1114959..1115834
Genome map
AA seq 291 aa AA seqDB search
MINLTCQDNETLDRILAVTRAVGWGGAKILQSYYRGEQDLAVNKKKKGGPVTAADLAANN
YILGELQTNFSDIDFGYLSEETHQGNEAIPKDWVWIIDPLDGTRDFINKTGEYALHIALC
YQGRPLIAVVALPDQEKLYFAQKGKGTFLETSDGNITQVKVANKDKITELYLVVSRTHRD
QRFDNLLSQIPFFGKNYVASVGCKIATILEQKSDVYISLSGKSAAKDWDFAAPELILTEA
GGKFSYFDGQPVRYNRGDVRQWGGIMASNGPCHQQLCQLSTAILAQIDATV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttaacctgtcaagataacgaaacgctcgatcgcattttagctgtgactcgt
gccgtcggttggggtggtgctaaaattcttcaatcctactaccggggtgaacaggattta
gccgtcaacaagaagaaaaaaggcggaccagtgacggcggcggatttagcggcaaataac
tatattttaggggaattacaaacaaatttctcggatatcgactttggttatctgagcgag
gaaacccatcaaggcaatgaagctatcccgaaagattgggtatggattatcgatcctttg
gacggaacccgcgattttatcaacaaaacgggagaatatgccctacatatcgccttatgt
tatcagggaagaccgctcatcgccgtggttgccctaccggatcaagaaaaactctatttt
gcccaaaaaggaaaaggtacttttctagaaactagcgacggaaatattacacaggtaaaa
gttgccaataaagataaaattaccgagctctatctggtggttagtcgtacccatcgcgac
caacgttttgataatttattaagtcaaatacccttcttcggtaaaaattatgtggctagt
gtgggctgtaaaattgccacgatcctcgaacaaaaatccgatgtttatatctccctatcg
gggaaatcggcggctaaagactgggattttgccgctccggagttgattttaacggaagcc
ggcggcaaattttcctattttgacggtcaacccgtgcgctataatcgcggcgatgtgcgg
caatggggggggatcatggctagtaatggtccttgtcatcaacaactttgtcagttgtcc
acggcaatcctcgcccaaattgatgccactgtctaa

DBGET integrated database retrieval system