KEGG   Microcystis aeruginosa: MAE_17060Help
Entry
MAE_17060         CDS       T00647                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mar  Microcystis aeruginosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAE_17060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAE_17060
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MAE_17060
Enzymes [BR:mar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MAE_17060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1521524..1522828)
Genome map
AA seq 434 aa AA seqDB search
MTLATNIETSKFIPTFTRLVSKEGGTSYPLKALNICEETFAPLEVDYDYDLIRRTVTRES
IQAGPNSIWRYRSFLPVESENPIDVGTGMTPLVKSHRLARRLGLKNLYIKNDAVNMPTLS
FKDRVVSVALTRAKELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLEAGKILGT
LIYNPTVMAVKGNYDQVNRLCSEVGNTYGWGFVNINLRPYYSEGSKTLGFEVAEQLGWKL
PDHIVAPLASGSLFTKIYKGFQEFVKVGLVADKAVRFSGAQAEGCSPIAQAFKEGRDFVA
PVKPNTIAKSIAIGNPADGVYALDIARKTGGNIESVTDAEIIEGIKLLAETEGIFTETAG
GTTIAVLKKLVEAGKIDPEETTVVYITGNGLKTQEAVQGYIGEPLLIEPKLESFERALER
SRTLERLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaccctagcgacaaacatcgaaacctcaaaattcatccccacctttacccgcttggtt
tctaaggaaggagggacctcctaccccctgaaagcgctgaatatctgcgaagaaaccttt
gcccccctggaagtggactacgattacgacctcatccgtcgcaccgttaccagagaaagc
attcaagccggtcccaattccatctggcgctatcgttcctttttgccggtggaaagtgaa
aatcctatcgatgtgggtacgggtatgactcccctagttaaatcccaccgtttagcccgg
cgcttgggtctaaaaaatctctacattaaaaatgatgccgtcaatatgcccactctcagc
ttcaaagatagagtggtatccgtcgcccttacccgggccaaagaattaggttttaccacc
gtttcctgtgctagtacgggaaatctcgccaattccaccgccgctattgccgctcacgcc
ggtttagactgttgtgttttcattccctccgacttagaagcgggtaaaattctcggcacc
ctaatctataatcccacggtaatggcggttaaaggcaattacgatcaggtcaaccgtctc
tgttcagaagtgggcaacacctacggttggggttttgtcaacatcaatctgcgtccctac
tattccgaaggttccaaaaccttaggctttgaagtggccgaacaattaggctggaaactc
cccgatcatattgtcgcacctttagccagtggttccctctttaccaagatttataaaggc
ttccaagaattcgtcaaagtcggtttggtggcagataaagcagtgcgttttagtggcgct
caagcggagggttgttcccccattgcccaagctttcaaggaaggacgggattttgtcgcc
ccagttaaacccaatactatcgccaaatcgatcgctattggtaatcccgccgatggtgtt
tatgcccttgatattgcccgtaaaactggcggtaatattgaatccgtcaccgatgccgaa
attatcgaaggtattaaacttttggcagaaacggaaggcattttcacggaaaccgcgggc
ggtacgactatcgctgtcttgaaaaaattagtagaagcgggtaaaatcgaccccgaagaa
accacggtcgtttatatcactggtaatggtctaaaaacccaagaagcggtacagggttat
atcggtgaacccctgttaatcgaaccgaaattagaaagctttgaacgggccctggaacgt
tcccgcaccctcgaacgcctcgaatggcaacaggttctcgtctag

DBGET integrated database retrieval system