KEGG   Microcystis aeruginosa: MAE_17780Help
Entry
MAE_17780         CDS       T00647                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mar  Microcystis aeruginosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAE_17780 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAE_17780 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAE_17780 (trpB)
Enzymes [BR:mar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAE_17780 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1601380..1602627)
Genome map
AA seq 415 aa AA seqDB search
MTITPIYAASAGTATQYPDAFGRFGRYGGKYVPETLMPALSELETAYNQYQDDPDFQEEL
NQLLKDYVGRPSPLYFAERLTAHYAKADGTGAQIYLKREDLNHTGAHKINNALGQVLLAK
RMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGIHDMERQELNVFRMRLLGATVQPV
AAGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGQETRQQSLEK
WGGLPDILLACVGGGSNAMGLFHEFVKEASVRLIGVEAAGESIASGKHAATLTQGQPGVL
HGAMSYLLQDSEGQVIEAHSISAGLDYPGVGPEHSFLKDSGRAEYYSVTDREALEAFQRV
SRLEGIIPALETAHALAYLETLCPQVTGSPRIVINFSGRGDKDVQSVAKYLSMNG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactatcacgccgatttatgccgcctcagccggcacagcaacccagtatcccgatgct
tttgggcgttttggacgctacgggggcaaatacgtcccggaaaccctgatgccagcctta
agtgaactagaaacggcctataatcagtatcaagacgaccccgattttcaagaagaatta
aatcaactgctcaaggattacgtcggtagacccagtcccttatattttgccgaacgtctc
accgcccattatgccaaagctgacggcactggggcgcaaatttacctgaaacgggaagat
ttaaaccataccggggcccacaagattaataacgccctcggtcaggttttattagccaaa
cgcatgggtaaaaagcgaattatcgccgaaaccggggcaggacagcacggcgtggccacc
gctacggtttgcgctcgttttggtctagaatgcgtgatttatatgggaattcacgacatg
gaacgccaggaactcaatgttttccgcatgagactgcttggggcgacggtgcaacccgtg
gccgccgggacaggaaccctgaaagatgccacctcggaagcgattcgcgactgggtaacg
aatgtggaaaccactcactacatccttggttctgtggcaggtccccatccctatccgatg
atggtgcgcgattttcacgcggttatcggtcaagaaactcgtcagcaaagtctggaaaaa
tggggcggtttaccggatattctcctcgcttgtgtggggggtggttctaatgctatgggt
ttatttcatgagtttgttaaagaagcttccgtgcgtttaattggtgttgaggccgccggg
gaaagtatcgcttccggaaaacacgccgccacccttacccaaggtcaaccgggggttcta
catggagcaatgagttatttattacaagatagcgaaggtcaagttatcgaggcccactcc
attagtgccggtttagattatcccggagtcgggccagaacatagctttttaaaagatagt
ggtcgcgccgaatattacagtgtcactgaccgggaagcattagaagcttttcaaagagtt
tcccgtttagaagggattattccggccctagaaactgcccacgctttagcctatttagaa
actctttgcccgcaagtaactggtagtcctcgcattgttattaatttctctggacggggt
gataaagatgtgcaatcggtggctaaatatttatcgatgaatggttaa

DBGET integrated database retrieval system