KEGG   Microcystis aeruginosa: MAE_18450Help
Entry
MAE_18450         CDS       T00647                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mar  Microcystis aeruginosa
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAE_18450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_18450
   00052 Galactose metabolism
    MAE_18450
   00500 Starch and sucrose metabolism
    MAE_18450
   00520 Amino sugar and nucleotide sugar metabolism
    MAE_18450
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MAE_18450
   00524 Butirosin and neomycin biosynthesis
    MAE_18450
Enzymes [BR:mar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MAE_18450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1655353..1656270)
Genome map
AA seq 305 aa AA seqDB search
MVKTVIGVDLGGTAIKIGKFDQEGNCLESLTLPTPQPATPKEVALTIHQGICQVNLDKSC
QAIGVGTPGPADAQGRIAKIAINLAGWRDIPLADWLEESTGMPTILANDANCAGLGEAWL
GAGKRFQNLILLTLGTGVGGAIILDGNLFVGSKGTAAELGLITLNFDGPLCNSGNRGSLE
QYVSRQAIRRMTGKEPKQLAELAEKGDREALEFWQRYGCLLGAGIASLLYVLTPEAVIIG
GGISASAKFFFPSLLTEIEGRVLPSSREGLEVLTAELGNRAGMVGAAKLAWQLLDLRKES
IMGGD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaacagtaataggtgtcgatttaggtggaactgcgattaaaattggtaaattt
gaccaagagggcaattgtctcgaatctctcaccttgcccactccccaacccgctacaccc
aaagaagtcgcccttaccatacatcaaggcatttgtcaagtaaatttagataaaagttgt
caagccatcggtgtgggaacgccggggccggcggatgctcagggaagaattgccaaaata
gcgattaatttggcaggatggcgggatattcccctcgccgattggttagaagaaagtacg
ggaatgccgacaattttagccaatgatgccaattgtgccggtttgggggaagcttggtta
ggagcgggcaaacggtttcaaaacttgatcctgttgaccttggggacgggagtaggaggg
gcaattatcctcgatggtaacttatttgtgggcagcaagggaacagccgcagaattaggc
ttaataaccctcaattttgacggtccattgtgcaatagcggtaatcggggttccttggaa
caatacgtctcccggcaagctattcgccggatgaccggcaaagaaccgaagcaattggca
gaattggccgaaaaaggcgatcgagaggctttagaattctggcagcgttacggctgttta
ctgggggctggtatcgccagtttactctatgttctcactccagaggcggtaattatcggc
ggcggcattagcgccagtgctaagtttttctttccctctctgctcacagaaatcgaagga
cgggtgttacctagttccagagaaggattagaggtattaacggccgagttaggtaatcgc
gctgggatggtgggggccgctaaattagcttggcaattattggacctccgcaaggagtct
attatggggggggactga

DBGET integrated database retrieval system