KEGG   Microcystis aeruginosa: MAE_18840Help
Entry
MAE_18840         CDS       T00647                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mar  Microcystis aeruginosa
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MAE_18840
Enzymes [BR:mar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MAE_18840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1688572..1689750
Genome map
AA seq 392 aa AA seqDB search
MSEESTFQPPHLTEAEQALEKERHLPLTGWQQEVSQGLTYGLEAADSIRDRSIPTFSRGE
LPHYAGINTFMKAPYLEDVRNVGNYDVAIVGVPHDSGTTYRPGTRFGPQGIRRISALYTP
YNFELGVDLREQITLCDLGDIFTIPANNEKSFDQISKGVAHVFSSGALPIILGGDHSIGF
PTVRGICRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMKNAPAKNLVQLGIG
GWQVPRQGVKVCRERATNILTVTDIVERGIDAAAEFALERALDGTDCVWISFDIDCIDAG
FVPGTGWPEPGGLLPREALALLGKIIQKAPICGMEVVEVSPPYDISDMTSLMATRVICDA
MAHLVISGQLPRKEKPYYIHSDANMEVDEPWI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggaatctacttttcaacccccgcatttaaccgaagctgaacaggccctagaa
aaagaacgccatttgcccctaaccggttggcaacaggaagtttcccaggggttaacctac
ggtttagaggcggccgatagtattcgcgatcgcagtattcccaccttttccaggggtgag
ttaccccactatgcgggaattaacacctttatgaaggccccctatttggaagatgtgcgg
aatgtgggcaattatgacgtggcaatcgtcggtgttccccatgattcggggacaacttac
cgacccggaactcgttttggtccccaaggaattcggcggatttcggccctttatacgccc
tacaattttgaattaggagtagatctgcgcgaacaaattactctctgtgatctgggggat
attttcaccattcctgctaataatgaaaagtccttcgatcaaatctcgaagggggttgcc
catgtctttagttctggcgccttgccgattattttagggggtgatcattccattggtttt
ccgacagtgcggggtatttgtcggcatttaggggataaaaaagtcggtattattcacttt
gatcgccatgtggatactcaggaaacggatttagatgaacggatgcacacttgcccctgg
tttcatgccaccaatatgaaaaatgctcctgctaaaaatctcgtccaattagggattggt
ggttggcaagttccccgtcaaggtgttaaagtttgccgcgagcgggccactaatattttg
accgtcaccgacattgtggaacgaggcattgatgcggccgccgaatttgccttagaacga
gctttagatggtacggattgcgtttggattagtttcgatattgattgcattgatgccggt
tttgtccccggtacaggttggccagaacctggcggtttattaccccgtgaagccttagct
ttattaggtaaaattattcaaaaagctcccatttgtggtatggaagtggtggaagtttcc
cctccctacgatattagtgatatgacctctttgatggctacccgtgttatttgtgatgcc
atggcccatctggttatttcaggtcaattaccccgtaaagaaaagccctattatattcat
tctgatgccaatatggaggttgatgaaccttggatttaa

DBGET integrated database retrieval system