KEGG   Microcystis aeruginosa: MAE_20980Help
Entry
MAE_20980         CDS       T00647                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mar  Microcystis aeruginosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAE_20980 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAE_20980 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAE_20980 (trpA)
Enzymes [BR:mar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAE_20980 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1872054..1872848)
Genome map
AA seq 264 aa AA seqDB search
MTAVTECFRSLRSQGNCALIPFITAGDPDLSTTAQALRILDRAGADLIELGVPYSDPLAD
GPVIQSAATRALNRGVKLEDVLEIVKNAQGEVKAPIILFTYYNPIYHRGIDVFLDQIKAA
GVSGLVVPDLPLEEAESLLQPAAAKGIEVILLVAPTSPPERIQAIALQSQGFIYLVSVTG
VTGMRKQVATRVEELLDSIRSVTDKPVGVGFGISEPTQALQVKNWGADAVIVGSAMVKRL
ADNSPSDGLKSLEEFCRSLKQAIQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgttaccgagtgttttcgttctctccgttcccaggggaattgtgccttaatt
ccctttattactgccggtgatcccgatttgtccactactgcccaagctttacgcatttta
gaccgggcaggggccgatctgatcgagttgggggttccctattccgatcctcttgcggat
ggtccggttattcaatcggcggccacgcgcgctttaaatcggggtgtcaagttggaagat
gtgctagaaatcgtcaaaaatgctcagggagaggtgaaagctcccattattctctttact
tactataatcccatctatcatcgcgggatagatgtctttttagaccaaataaaagcggcc
ggggtgagtggtttggtggttcccgatttacccctagaggaagcggaaagtctgctgcaa
ccggctgccgctaagggaattgaagtgattttattggtagcgcctaccagtcccccggaa
cgaatacaagcgatcgccctgcaatcccaaggttttatttatctggtgagtgtcacggga
gtgacgggaatgcggaagcaagtggccaccagagtggaggaattgctcgattctatccgt
tctgtcaccgataaacccgtgggggtaggatttggcatttctgagccgacacaggcgcta
caggtgaaaaactggggtgctgatgcggtaattgtgggcagtgccatggttaaacgttta
gccgataattcccccagcgatgggttaaaatccctcgaagaattctgtcgcagtttaaaa
caggcgattcagtaa

DBGET integrated database retrieval system