KEGG   Microcystis aeruginosa: MAE_21460Help
Entry
MAE_21460         CDS       T00647                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mar  Microcystis aeruginosa
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mar01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mar00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1922916..1924220
Genome map
AA seq 434 aa AA seqDB search
MVRILKLSQLSSAERAKLQKRAELDIDNALKVAQTVIETIRERGDAGVVDYVRRFDYEGA
TVENIKVSEAEFERAFHLIEPEVKTAIEQAFRNIQEVHRRQMPEETLLAEIETGVFAGEK
ISPIPNVGLYVPRGRGAFPSMMLMLAIPAMVAGVERVVVCTPPDKQGNVEPVSLVAAQMA
GVREIYKLGGVQAIAALALGTKNIKRVDKITGPCSVYGAAAKRLLFGTVDVGLPAGPSES
IVLADESTDARLAALDLLIEAEHGADSAALLVTHCEDLAIAASEYAQEYLQKLPDWRREF
CEAGLAAYGGIILTDSLQQSLDFVNEYAPEHLEVLVSNPFAILGKIKNAGEILLGNHTPS
SMATYAIGVNAVLPTGSFARSYSAVSVYDFLKRSTLAYVTPEGFEKLKETTKTLAEYEGF
PAHKLAIQHREILL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggttagaatattaaaactttcgcaattaagtagcgcagaacgggcaaaacttcagaaa
agagccgagttagatattgataacgccctcaaagtcgctcaaacggtcatagaaaccatc
cgcgaacggggggatgccggcgttgtggactatgtgcggcgttttgactacgaaggtgcg
acggtagaaaatatcaaagtcagcgaggcagaatttgagcgggcttttcatttaattgaa
ccggaagtaaaaactgccattgaacaggctttccggaatattcaagaggtacatcgtcgc
caaatgccagaagaaacactactggcagaaattgaaaccggtgtctttgccggcgaaaaa
atctctcctatccccaatgtgggtttatacgttccccggggccgcggtgcttttccctcg
atgatgttaatgttagccatcccggcaatggtggcaggagtggaaagagttgtcgtttgc
actccccccgataaacagggcaacgtggaacccgtttctctggtggcggcgcagatggct
ggagtcagagaaatttataaattagggggcgtacaagcgatcgccgctttggctttggga
acaaaaaatatcaaaagggttgacaaaattaccggtccgtgcagcgtctatggggcggcg
gccaagcggttactgttcggtactgtggatgtgggtttgccggccggtccaagtgagtcg
atagttttggccgatgagtccaccgatgcccgtttagcggccttggatttattaattgaa
gcggaacacggggcggattcggcggctttattagtcacccactgtgaagatttggcgatc
gctgctagtgaatatgcacaggaatacctgcaaaaactcccggattggcgacgggaattc
tgtgaggcgggtttagccgcctatgggggcataattttaaccgatagtttgcagcaatcc
ctcgattttgtcaatgagtacgccccggaacatctagaggttttagttagtaatcctttt
gccattctgggcaagattaaaaatgctggcgaaattctcctgggaaatcatactccttcc
tctatggctacctacgccatcggagtcaatgctgtgctgccgacgggaagttttgcccgt
tcctattcggcggtttcggtttatgattttctcaagcgctccactttggcttatgtcacc
cctgaaggctttgaaaagttaaaagaaaccacgaaaactttagccgagtacgaaggtttt
cccgcccataaattagcaattcaacacagggaaattttactctaa

DBGET integrated database retrieval system