KEGG   Microcystis aeruginosa: MAE_21650Help
Entry
MAE_21650         CDS       T00647                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mar  Microcystis aeruginosa
Pathway
mar00330  Arginine and proline metabolism
mar00332  Carbapenem biosynthesis
mar01100  Metabolic pathways
mar01130  Biosynthesis of antibiotics
mar01230  Biosynthesis of amino acids
Module
mar_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MAE_21650 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MAE_21650 (proB)
Enzymes [BR:mar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MAE_21650 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAG01987
CYORF: MAE_21650
UniProt: B0JFY2
Position
complement(1942328..1943467)
Genome map
AA seq 379 aa AA seqDB search
MNQTIVIKIGTSSLTDNETGQLSLSTIAALVEVLTRLRAAGHRVVLVSSGAVGVGCRRLG
IQERPKKIALKQAIAAVGQGRLMRIYDDLFTSLGQPIAQILLTRPELMERTCYVNAYNTF
QALFELGVIAIVNENDTVAIDELKFGDNDTLSALVASLIEADWLFILTDVDRLYSADPRL
FPEAAAIARVSPAELAQLSIDAGSSGSQWGTGGMATKLAAARIATSAGVEMAITRGRQPG
NILKIMAGEAIGTRFEAQKRSDNARKRWIAYGLLPMGKIYLDAGAIQAICQGGKSLLAAG
ITKVEGEFSASESVQLCDQEGRELARGIVNYSSEEIDRVKGQHSERIASLLGYMAAETII
HRDNLVILSASSTTSTNKG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaccatagtgatcaaaatcggtacttccagtttgaccgataatgaaaccggc
caattatccctctccacgatcgccgctttagtggaagtcctcacccggttgcgcgctgcc
ggtcatcgggtggtattagtatcttccggggccgtgggggtgggctgccgtcgtctggga
atacaggaaagaccgaaaaaaatcgccctcaaacaagcgatcgccgccgtcggtcaaggt
cgtctgatgcggatctatgatgacctctttaccagtcttggtcaaccgatcgcccaaatt
ttgctgacccgtcccgaattgatggaacgcacctgttatgtcaacgcctataataccttt
caggctttgtttgaattaggggtgattgccattgtcaacgaaaatgatacggtggcgatc
gatgagttaaaattcggcgataatgacactttatcagcccttgtagccagtttaatcgag
gctgactggttatttatcctcaccgatgtggatcgcctctacagtgccgatccgcggcta
tttcccgaagcggcggctattgcccgagttagtcccgcggaattagcgcaactatcgatc
gatgccggtagtagtggcagtcagtgggggaccgggggtatggcgactaaattggcggcg
gcccggattgccaccagcgccggggtagaaatggcgattactaggggacggcagcccggt
aatatcttaaaaattatggcaggagaggcgatcggaacccgttttgaggcccaaaaacgc
agtgataacgcccgcaaacgctggatcgcctacggactactgcccatgggtaaaatctat
ctcgatgctggggcgattcaagccatttgtcaggggggaaaatctctccttgcggccgga
atcaccaaagtggagggggaatttagcgcctcggaatcggtgcaattgtgcgatcaagaa
ggccgggaattggccaggggaattgttaattatagtagtgaggagatcgatcgagtgaaa
ggtcaacattccgagcgtattgccagtttattaggttatatggccgcagaaaccatcatt
catcgggataatctcgtcattttgagtgcctcgtccaccacctcgactaataaaggataa

DBGET integrated database retrieval system