KEGG   Microcystis aeruginosa: MAE_21650Help
Entry
MAE_21650         CDS       T00647                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mar  Microcystis aeruginosa
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAE_21650 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MAE_21650 (proB)
Enzymes [BR:mar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MAE_21650 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1942328..1943467)
Genome map
AA seq 379 aa AA seqDB search
MNQTIVIKIGTSSLTDNETGQLSLSTIAALVEVLTRLRAAGHRVVLVSSGAVGVGCRRLG
IQERPKKIALKQAIAAVGQGRLMRIYDDLFTSLGQPIAQILLTRPELMERTCYVNAYNTF
QALFELGVIAIVNENDTVAIDELKFGDNDTLSALVASLIEADWLFILTDVDRLYSADPRL
FPEAAAIARVSPAELAQLSIDAGSSGSQWGTGGMATKLAAARIATSAGVEMAITRGRQPG
NILKIMAGEAIGTRFEAQKRSDNARKRWIAYGLLPMGKIYLDAGAIQAICQGGKSLLAAG
ITKVEGEFSASESVQLCDQEGRELARGIVNYSSEEIDRVKGQHSERIASLLGYMAAETII
HRDNLVILSASSTTSTNKG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaccatagtgatcaaaatcggtacttccagtttgaccgataatgaaaccggc
caattatccctctccacgatcgccgctttagtggaagtcctcacccggttgcgcgctgcc
ggtcatcgggtggtattagtatcttccggggccgtgggggtgggctgccgtcgtctggga
atacaggaaagaccgaaaaaaatcgccctcaaacaagcgatcgccgccgtcggtcaaggt
cgtctgatgcggatctatgatgacctctttaccagtcttggtcaaccgatcgcccaaatt
ttgctgacccgtcccgaattgatggaacgcacctgttatgtcaacgcctataataccttt
caggctttgtttgaattaggggtgattgccattgtcaacgaaaatgatacggtggcgatc
gatgagttaaaattcggcgataatgacactttatcagcccttgtagccagtttaatcgag
gctgactggttatttatcctcaccgatgtggatcgcctctacagtgccgatccgcggcta
tttcccgaagcggcggctattgcccgagttagtcccgcggaattagcgcaactatcgatc
gatgccggtagtagtggcagtcagtgggggaccgggggtatggcgactaaattggcggcg
gcccggattgccaccagcgccggggtagaaatggcgattactaggggacggcagcccggt
aatatcttaaaaattatggcaggagaggcgatcggaacccgttttgaggcccaaaaacgc
agtgataacgcccgcaaacgctggatcgcctacggactactgcccatgggtaaaatctat
ctcgatgctggggcgattcaagccatttgtcaggggggaaaatctctccttgcggccgga
atcaccaaagtggagggggaatttagcgcctcggaatcggtgcaattgtgcgatcaagaa
ggccgggaattggccaggggaattgttaattatagtagtgaggagatcgatcgagtgaaa
ggtcaacattccgagcgtattgccagtttattaggttatatggccgcagaaaccatcatt
catcgggataatctcgtcattttgagtgcctcgtccaccacctcgactaataaaggataa

DBGET integrated database retrieval system