KEGG   Microcystis aeruginosa: MAE_25030Help
Entry
MAE_25030         CDS       T00647                                 

Definition
(GenBank) NAD(P)-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mar  Microcystis aeruginosa
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAE_25030
   01230 Biosynthesis of amino acids
    MAE_25030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_25030
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MAE_25030
Enzymes [BR:mar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MAE_25030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2267080..2268096)
Genome map
AA seq 338 aa AA seqDB search
MIRVAINGFGRIGRNFLRCWLGRTNSGLEVVGINDTSDPRSNAHLLKYDSMLGKLNANID
ADDNSLIVNGKTIKCYSDRNPLNLPWAEWGVDLVIEATGVFVDEEGASKHIVAGAKKVLI
TAPGKGSGVGTYVVGVNAHEYEHDKYNVISNASCTTNCLAPVVKVIHENFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPEMKGKLNGIALRVPTPN
VSVVDLVAQVEKSTIAEQVNEVLKEAAENSLKGILEYNDLPLVSSDYRGVDASSIIDASL
TMVMGGDMVKVIAWYDNEWGYSQRVVDLAEVVASKWKG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcgatcaatggtttcggacggattggacgtaatttcctaagatgttgg
ttaggacggactaatagtggcttggaggtagtggggatcaatgatacatccgatccccgg
agtaacgctcacctgctcaaatatgattcgatgttaggcaaacttaacgctaatatcgat
gccgatgataattctttaattgttaacggtaaaaccattaaatgttattccgatcgcaat
cccctcaatctgccctgggcagaatggggtgtagatctagtgatcgaagctactggtgtt
ttcgtcgatgaagagggcgcttctaagcatattgtcgcaggagctaaaaaagtcctcatt
accgcaccgggtaaaggttcgggtgtgggaacctatgtcgtcggtgtcaacgctcacgaa
tacgaacacgataaatacaatgtcatcagcaatgccagttgtaccaccaactgtcttgct
cctgtcgtcaaagtgattcacgaaaacttcggcatcatcaaagggacgatgaccaccacc
cacagttacactggtgatcaacgcattcttgatgctagtcaccgggatctccgtcgcgct
cgcgccgctgccgttaacatcgttcccacctccaccggtgccgctaaagctgtagcctta
gttatccccgaaatgaaagggaaacttaacgggatcgccctgcgtgtacccactcctaac
gtttctgtggtggatttagtcgcacaagtggaaaaaagcacgatcgcggaacaggtaaac
gaagtcctcaaagaagctgcggaaaattctttgaaaggaattctcgaatataatgattta
cccctcgtttcctctgattatcgcggtgttgatgcctcctcgatcatcgatgctagtcta
acgatggtgatgggtggcgatatggtgaaagttatcgcttggtacgataatgaatggggt
tactctcaacgcgtggttgatctcgctgaagtcgttgccagcaagtggaaaggctaa

DBGET integrated database retrieval system