KEGG   Microcystis aeruginosa: MAE_25180Help
Entry
MAE_25180         CDS       T00647                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mar  Microcystis aeruginosa
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mar03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2280026..2280883
Genome map
AA seq 285 aa AA seqDB search
MPELPEVETVRRGLNQVTQGQKIIGGEVLLQRTLAYPNCEATFLQGIAQTTITNWQRRGK
YLLANLDNGSSIGVHLRMTGQLLWVKDTTPLPIHTRLRFFFANQQELRFVDTRTFGKIWW
IAADKTPESVITGLKKLGLEPFDRNFTADYLYSHCQKSRRPIKTFLLDQNVVAGIGNIYA
DEVLFKSGIHPQTAANLLKIEQIDLLTKNIISVLETAIAEGGTSFSDFLHVTGVNGNYGA
MAWVYGRNGENCRLCGATIARIKLSGRSAHFCPQCQVSRGEGRKS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattgccagaagtagaaacggtgcgtcgcggattaaatcaagttacccagggc
caaaaaattatcggtggggaagtattattacagcgtaccctagcctatcctaattgcgag
gcaacttttctgcaaggaattgctcagaccacgattaccaattggcagcgccgaggcaaa
tatctcctcgccaatttagataatggtagcagtatcggggttcatctgcgtatgactgga
caattgctctgggtaaaagataccactcccctgccgattcatacgcgcttacgcttcttt
tttgccaatcagcaagaattgcgcttcgtcgatacccgcactttcgggaaaatttggtgg
attgccgccgataaaaccccagaaagcgtgattactggtctcaaaaaactgggattggaa
cccttcgatcgcaattttaccgccgattacctctatagtcactgtcaaaaaagtcgtcgt
ccgattaaaacttttctcctcgatcaaaatgtagtcgcaggaattggcaatatctacgca
gatgaagttctttttaaaagtggcatccatccccaaactgccgctaatctcttgaaaatt
gagcaaatagacttattgacaaaaaacattatttctgtattggaaacagcgatcgctgaa
ggcggaaccagttttagcgattttctccacgttacgggagttaatggcaattatggggcg
atggcctgggtttacggtcgtaatggcgaaaattgtcgcctttgcggtgcaactattgcc
agaattaaattaagtgggcgctcggctcatttttgtccccagtgtcaagtctcaagggga
gaagggagaaaaagctga

DBGET integrated database retrieval system