KEGG   Microcystis aeruginosa: MAE_27160Help
Entry
MAE_27160         CDS       T00647                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mar  Microcystis aeruginosa
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAE_27160 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_27160 (glk)
   00052 Galactose metabolism
    MAE_27160 (glk)
   00500 Starch and sucrose metabolism
    MAE_27160 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MAE_27160 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MAE_27160 (glk)
   00524 Butirosin and neomycin biosynthesis
    MAE_27160 (glk)
Enzymes [BR:mar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MAE_27160 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2453923..2454969)
Genome map
AA seq 348 aa AA seqDB search
MTILLGGDIGGTKTILRLVDCQNSSDSPQPRLITLDQEIYPSKQYPDLVPIVQQFLARQT
TIPPVEKACFGIAGPVVNNSSELTNLSWSLTGDRLSHELQIERVKLINDFAAIGYGVLGL
APEELHNLQSAPTVPEAPIAVIGAGTGLGEGFLIPVSKGKYQVFASEGSHADFAPRSSLE
YQLLNYLLELYNIERLSVERVVSGPGITSIYRFLHDSNSSQSSPAMAEIYRTWLAEMGKP
QKTVDLAAKIASFAQDDSDDLCYQTMKIFVEAYGAEAGNLALKLLPYGGLYIAGGIAAKN
LPLMTEGSFMKAFRAKGRMRELLSNIPVHIVLNAQVGLMGAVSCASQL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcttttagggggagatatcgggggaactaaaacaatcctgcgtttagtggat
tgccaaaactcatcggatagtccccaaccccggctaattactctcgatcaagaaatttat
cctagtaaacaataccccgatctggtgccgatcgtccagcagtttttagcccgacaaacc
actattcccccagtggaaaaagcttgtttcggtattgccggtccagtggttaacaatagt
tccgaattgactaatttaagttggtctctaactggcgaccgcctaagccacgagctgcag
attgagcgggtaaaattaattaatgattttgcggcgatcggttatggggtgttaggatta
gccccagaggagctgcacaatctacagtcggccccaacagtaccagaggccccgattgcg
gttatcggtgcggggacggggttaggagagggttttttgattcctgtgtcgaagggtaaa
tatcaggtgtttgctagtgagggttcccacgccgattttgcccctcgatcgagtttagaa
tatcaactattaaattatctcttggaactctataatatcgagcgcctttcggtggagcga
gtggtttctggtcctggaatcacttctatctatcgatttctccacgatagtaactctagt
cagtcatcgccagccatggcggaaatttaccgcacttggttagcagaaatgggtaaacca
caaaaaaccgtggatttagcggctaaaattgccagttttgcccaagatgactcggatgat
ctctgttatcaaaccatgaaaatctttgtcgaggcctacggtgcggaagcgggcaattta
gccctcaagttgcttccctacggaggattatacatagcgggggggattgcggccaaaaat
cttcccctaatgactgaggggagctttatgaaggcttttcgggctaaaggtcggatgagg
gagctattaagcaatattcccgtccatatcgtccttaatgcccaagtgggactaatgggg
gcagtttcctgcgctagtcagctatga

DBGET integrated database retrieval system