KEGG   Microcystis aeruginosa: MAE_39290Help
Entry
MAE_39290         CDS       T00647                                 

Definition
methylenetetrahydrofolate reductase
Orthology
K00297  
methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mar  Microcystis aeruginosa
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mar01200]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mar00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3613459..3614352)
Genome map
AA seq 297 aa AA seqDB search
MTTRLRRAVQDREFLITAEITPPKGGNASHMLEMALWLKNRVHAANITDGSRAVVRMSSL
AASAILYQHDIEPICQMACRDRNVIGLQADLMGAHALGLRNILALTGDPVKAGDHPQARA
VFDLESVRLLKLIDKLNKGFDFNDKSLPDGPLELFAGAAVDVQSKSKSGLQRRFERKIEA
GAQFFQSQLVTDFECLDKFMQQVASLADKPILAGIFLLKSAKNAVFLNKNVPGVQIPDHI
IQRLADAAHPLEEGIKIAAEQIKLAQQLCQGVHIMAIKREDLVPKILDVAGIPPVHN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgtttacgacgcgcggttcaagaccgagaatttttgattacagccgagatt
actcccccgaaagggggtaatgccagtcatatgctagaaatggccctctggctaaaaaat
cgtgttcatgcggctaacattaccgatggcagtcgcgccgtagtgcgaatgtcctctctg
gctgcctccgctattctctatcaacacgacatcgaacccatctgtcaaatggcctgtcgc
gatcgcaatgtgatcggattacaagcagatctcatgggcgctcatgctttgggattgaga
aatatactagctttaactggagatcccgtcaaagcaggagatcacccccaggctagagca
gtttttgacctagaatcggtacgtttgttaaaattaatcgataaattgaataaaggtttt
gactttaacgataaatctttaccggatggacccctagaactttttgctggggctgccgtt
gatgtgcagtcaaaaagtaagtctggtcttcaacgccgttttgagcgtaaaatcgaagcg
ggagcgcagttttttcaaagtcaattagttacggatttcgagtgtcttgataagttcatg
cagcaggtggcctcgctggccgataaaccgattctagcggggatttttctgttaaaatca
gctaaaaacgccgtatttttaaataaaaatgtgccgggggtacaaattcccgaccatatc
attcaaagactcgccgatgcagcccatcccctcgaagaaggcatcaaaatcgccgccgaa
caaataaaattagcccagcagttatgtcaaggtgtccacatcatggcgattaaacgggag
gatttagtcccaaaaattctcgacgtggccggtatcccgccagtacataactga

DBGET integrated database retrieval system