KEGG   Microcystis aeruginosa: MAE_39290Help
Entry
MAE_39290         CDS       T00647                                 

Definition
methylenetetrahydrofolate reductase
Orthology
K00297  
methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mar  Microcystis aeruginosa
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAE_39290
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MAE_39290
Enzymes [BR:mar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     MAE_39290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3613459..3614352)
Genome map
AA seq 297 aa AA seqDB search
MTTRLRRAVQDREFLITAEITPPKGGNASHMLEMALWLKNRVHAANITDGSRAVVRMSSL
AASAILYQHDIEPICQMACRDRNVIGLQADLMGAHALGLRNILALTGDPVKAGDHPQARA
VFDLESVRLLKLIDKLNKGFDFNDKSLPDGPLELFAGAAVDVQSKSKSGLQRRFERKIEA
GAQFFQSQLVTDFECLDKFMQQVASLADKPILAGIFLLKSAKNAVFLNKNVPGVQIPDHI
IQRLADAAHPLEEGIKIAAEQIKLAQQLCQGVHIMAIKREDLVPKILDVAGIPPVHN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgtttacgacgcgcggttcaagaccgagaatttttgattacagccgagatt
actcccccgaaagggggtaatgccagtcatatgctagaaatggccctctggctaaaaaat
cgtgttcatgcggctaacattaccgatggcagtcgcgccgtagtgcgaatgtcctctctg
gctgcctccgctattctctatcaacacgacatcgaacccatctgtcaaatggcctgtcgc
gatcgcaatgtgatcggattacaagcagatctcatgggcgctcatgctttgggattgaga
aatatactagctttaactggagatcccgtcaaagcaggagatcacccccaggctagagca
gtttttgacctagaatcggtacgtttgttaaaattaatcgataaattgaataaaggtttt
gactttaacgataaatctttaccggatggacccctagaactttttgctggggctgccgtt
gatgtgcagtcaaaaagtaagtctggtcttcaacgccgttttgagcgtaaaatcgaagcg
ggagcgcagttttttcaaagtcaattagttacggatttcgagtgtcttgataagttcatg
cagcaggtggcctcgctggccgataaaccgattctagcggggatttttctgttaaaatca
gctaaaaacgccgtatttttaaataaaaatgtgccgggggtacaaattcccgaccatatc
attcaaagactcgccgatgcagcccatcccctcgaagaaggcatcaaaatcgccgccgaa
caaataaaattagcccagcagttatgtcaaggtgtccacatcatggcgattaaacgggag
gatttagtcccaaaaattctcgacgtggccggtatcccgccagtacataactga

DBGET integrated database retrieval system