KEGG   Microcystis aeruginosa: MAE_45030Help
Entry
MAE_45030         CDS       T00647                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mar  Microcystis aeruginosa
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAE_45030 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAE_45030 (trpC)
Enzymes [BR:mar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MAE_45030 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4139131..4140021
Genome map
AA seq 296 aa AA seqDB search
MQIRRKHPNPAVKVESLSYVVKVPEAQPQNILEEIVWHKEIEVDKLRERLPLLELRQKIA
NTAPPCDFLAALKQGKTQPALIAEVKKASPSKGVILEDFDPVAIARTYEQGGATCLSVLT
DSKFFQGSYENLTLVRQAVSLPLLCKEFILYPYQIYYARSKGADAVLLIAAILSDQDLAY
FVKIVKGLGMTALVEVHSLAEFDRVLAIEGIELIGINNRNLETFTVDLDNTRQLLEARGE
QVREKGILIVSESGLHTATDLAKVKQAGANAVLIGESLVKLPDPALGIQKLFENLG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcagatccgaagaaaacaccccaatcctgccgtcaaagttgagagtttgagttatgtg
gtgaaagtgccagaggcacaaccgcaaaatattttagaagaaatcgtttggcataaggag
atagaagtcgataaattgcgcgaacggttgcctttattggaattacgccaaaaaatagcc
aatactgcgccaccttgcgactttttagccgccttaaaacagggtaaaacccaacccgct
ttgattgccgaagtgaaaaaagcttcccctagcaagggagttatcctggaagattttgat
cctgtagcgatcgcccgtacctatgaacagggaggggccacttgtttatcggttttaacc
gatagtaagttttttcaaggtagttacgaaaatcttaccctcgtccggcaagcggtatct
ttacccctattatgcaaggaatttatcctttatccctatcaaatctactacgctcgctct
aaaggagccgatgctgtccttttaattgccgctattttaagcgatcaagacttagcatat
tttgtcaaaattgtcaagggtttagggatgacagctttggtagaggtgcatagtctggct
gaatttgatcgagtgttagccattgagggaatcgaactaatcggcattaataaccgcaat
ttagagacatttacagtcgatttagacaatactcgccaattactagaagccaggggcgaa
caggtgcgagaaaaaggtattctgatcgtcagcgaatcgggattacacacagcaacagat
ctggcgaaagtgaagcaagcgggagcaaatgcggttctaattggcgaatctttggtaaaa
ctgcccgatcctgccctcggtatccaaaaactctttgaaaatctcggttag

DBGET integrated database retrieval system