KEGG   Microcystis aeruginosa: MAE_45780Help
Entry
MAE_45780         CDS       T00647                                 

Gene name
chlD
Definition
magnesium protoporphyrin IX chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mar  Microcystis aeruginosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mar00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4206436..4208433
Genome map
AA seq 665 aa AA seqDB search
MPTLTLNFPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIE
IIAGNVFNCDPNNADEWDDRTKEEYSSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEES
VKQGEPVFQPGLLASAHRGILYVDEINLLDDQIANQLLTVLSEGRNQIEREGISFQHPCK
PILIATYNPEEGDLRTHLLDRIAIALSADGVLSLDQRVTAVNQAIEYAVSPSAFIAQYAQ
EIDDLKTEIILAREWLKEVKIKPEQISYLVEEAVRGRVEGHRAEIFAVRVAKAAAALEGR
DLVSADDLKRAVELVIVPRSLITPPPPEQEQQPPPPPPPPEPPQDENQQEQEEKEEEKEE
EKEPEQPDNLPEEFVFDPEGVLLDPSVLYFAQMAQRQGKSGARNLIFSEDRGRYIKPMLP
RGKVKRVAVDATLRAAAPYQKARRLRNPERHVIIEEGDLRSKRLARKAGSLIVFVVDASG
SMALNRMQSAKGAVMRLLTEAYENRDQIALIPFRGERADVLLPPTKSITLAKKRLETLPC
GGGSPLAHGLTQAVHVGMNARLSGDIGQVVIVAITDGRSNIPLAKSLGEPIPEGEKPDIK
AELLDIAAKIRSLGIKLLVIDTEKKFVSTGFAKELALKAGGKYYHLPRATEQAIASMARG
AIAGL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcccactctgaccctcaattttcccctaactgccgttgtcggccaagaagcgattaaa
ttagccctactcttagccgccgtggatcccgccctggggggtgtggtaattgccggtcgt
cggggaaccgccaaatcagtcatggcgcgagcgatacattccttactgccaccgatcgaa
attatcgcaggtaatgtctttaattgtgatcccaataatgccgacgaatgggacgatcgc
actaaagaagaatatagcagtggagaggtcgccacggaagttatccgggcccctttcgtg
cagattcccctaggagtcaccgaggatcgtttattgggttccgtcgatgtggaagaatcg
gtgaaacagggggaaccagtctttcaacccggtttattagccagcgcccatcggggaatt
ctctacgtcgatgaaattaatctacttgatgaccaaattgctaaccaattactcacagtt
ttaagcgaaggacgtaaccaaatcgaacgggaaggcatcagttttcaacatccctgtaaa
ccaatcctgatcgctacttataacccagaagaaggggatttacgaacccatttattagat
agaattgccattgccctttccgccgatggtgtccttagtttagaccaacgagtaaccgcc
gtcaatcaggcgatcgagtatgctgtttctcccagcgcttttatcgcccaatatgcccaa
gaaatcgatgatctaaaaaccgaaattattctggcgagggaatggttaaaagaggtaaaa
attaaacccgaacaaattagttatctagtggaggaagcggtgcgcggtagggtagaaggt
catcgcgccgagatttttgccgtgagagtagccaaggccgccgccgctttagaaggtcgg
gatttagtcagtgccgatgacttaaaaagagccgtcgaattagttattgtacctcgatcg
ctgattacgccgccacccccagaacaggaacaacagccaccgccaccaccgccaccaccg
gaaccgccccaagacgaaaaccagcaggaacaggaagaaaaagaggaggagaaagaggaa
gaaaaagagccggaacagcccgataatctgccagaagaatttgttttcgacccggaaggg
gttttactggatcccagtgtgctgtattttgcccagatggcccagcgtcaggggaaatcg
ggggcgcgtaacctgattttctcggaagatagaggacgttatattaagccgatgttaccc
cggggcaaggtgaaaagagtcgccgtcgatgccactctccgggcggctgccccctatcaa
aaagcccgtcgcttaagaaatcccgaacgtcatgtgattatagaagaaggggatctgcgc
tcaaaacggctggcccgcaaggccggttctttaattgtctttgtggttgatgcctccggt
tccatggccctgaatcggatgcagtcggccaaaggtgcggttatgcgtctgttaacggaa
gcttacgaaaatcgcgaccagattgccctgattcctttccggggtgagcgagcagatgta
ctattgccaccgaccaaatcgattaccctagcgaaaaaacgtctggaaaccctgccctgt
ggtggcggttcccctttagcccacggtttaacccaagcggttcatgtggggatgaatgcc
cgtttatcgggggatatcggtcaagtggtgattgtggcgattaccgacggtagaagtaat
attcctttggcgaaatctttaggcgaaccgattccggagggtgaaaaacccgatattaag
gcagaactgctcgatattgccgctaaaattcgctctttaggcattaaactgctggttatc
gatacggagaaaaaattcgtctccactggttttgccaaagaattagccctaaaagctggg
ggtaaatattatcatctaccccgggccacggaacaagcgatcgcatctatggcgcgaggg
gcaattgcgggactgtag

DBGET integrated database retrieval system