KEGG   Microcystis aeruginosa: MAE_45780Help
Entry
MAE_45780         CDS       T00647                                 

Gene name
chlD
Definition
(GenBank) magnesium protoporphyrin IX chelatase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mar  Microcystis aeruginosa
Pathway
mar00860  Porphyrin and chlorophyll metabolism
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAE_45780 (chlD)
Enzymes [BR:mar01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MAE_45780 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 Sigma54_activat MCM VWA_3 CCDC53 AAA_16 PAXIP1_C VIR_N CAP_N
Motif
Other DBs
NCBI-ProteinID: BAG04400
CYORF: MAE_45780
UniProt: B0JUF2
Position
4206436..4208433
Genome map
AA seq 665 aa AA seqDB search
MPTLTLNFPLTAVVGQEAIKLALLLAAVDPALGGVVIAGRRGTAKSVMARAIHSLLPPIE
IIAGNVFNCDPNNADEWDDRTKEEYSSGEVATEVIRAPFVQIPLGVTEDRLLGSVDVEES
VKQGEPVFQPGLLASAHRGILYVDEINLLDDQIANQLLTVLSEGRNQIEREGISFQHPCK
PILIATYNPEEGDLRTHLLDRIAIALSADGVLSLDQRVTAVNQAIEYAVSPSAFIAQYAQ
EIDDLKTEIILAREWLKEVKIKPEQISYLVEEAVRGRVEGHRAEIFAVRVAKAAAALEGR
DLVSADDLKRAVELVIVPRSLITPPPPEQEQQPPPPPPPPEPPQDENQQEQEEKEEEKEE
EKEPEQPDNLPEEFVFDPEGVLLDPSVLYFAQMAQRQGKSGARNLIFSEDRGRYIKPMLP
RGKVKRVAVDATLRAAAPYQKARRLRNPERHVIIEEGDLRSKRLARKAGSLIVFVVDASG
SMALNRMQSAKGAVMRLLTEAYENRDQIALIPFRGERADVLLPPTKSITLAKKRLETLPC
GGGSPLAHGLTQAVHVGMNARLSGDIGQVVIVAITDGRSNIPLAKSLGEPIPEGEKPDIK
AELLDIAAKIRSLGIKLLVIDTEKKFVSTGFAKELALKAGGKYYHLPRATEQAIASMARG
AIAGL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgcccactctgaccctcaattttcccctaactgccgttgtcggccaagaagcgattaaa
ttagccctactcttagccgccgtggatcccgccctggggggtgtggtaattgccggtcgt
cggggaaccgccaaatcagtcatggcgcgagcgatacattccttactgccaccgatcgaa
attatcgcaggtaatgtctttaattgtgatcccaataatgccgacgaatgggacgatcgc
actaaagaagaatatagcagtggagaggtcgccacggaagttatccgggcccctttcgtg
cagattcccctaggagtcaccgaggatcgtttattgggttccgtcgatgtggaagaatcg
gtgaaacagggggaaccagtctttcaacccggtttattagccagcgcccatcggggaatt
ctctacgtcgatgaaattaatctacttgatgaccaaattgctaaccaattactcacagtt
ttaagcgaaggacgtaaccaaatcgaacgggaaggcatcagttttcaacatccctgtaaa
ccaatcctgatcgctacttataacccagaagaaggggatttacgaacccatttattagat
agaattgccattgccctttccgccgatggtgtccttagtttagaccaacgagtaaccgcc
gtcaatcaggcgatcgagtatgctgtttctcccagcgcttttatcgcccaatatgcccaa
gaaatcgatgatctaaaaaccgaaattattctggcgagggaatggttaaaagaggtaaaa
attaaacccgaacaaattagttatctagtggaggaagcggtgcgcggtagggtagaaggt
catcgcgccgagatttttgccgtgagagtagccaaggccgccgccgctttagaaggtcgg
gatttagtcagtgccgatgacttaaaaagagccgtcgaattagttattgtacctcgatcg
ctgattacgccgccacccccagaacaggaacaacagccaccgccaccaccgccaccaccg
gaaccgccccaagacgaaaaccagcaggaacaggaagaaaaagaggaggagaaagaggaa
gaaaaagagccggaacagcccgataatctgccagaagaatttgttttcgacccggaaggg
gttttactggatcccagtgtgctgtattttgcccagatggcccagcgtcaggggaaatcg
ggggcgcgtaacctgattttctcggaagatagaggacgttatattaagccgatgttaccc
cggggcaaggtgaaaagagtcgccgtcgatgccactctccgggcggctgccccctatcaa
aaagcccgtcgcttaagaaatcccgaacgtcatgtgattatagaagaaggggatctgcgc
tcaaaacggctggcccgcaaggccggttctttaattgtctttgtggttgatgcctccggt
tccatggccctgaatcggatgcagtcggccaaaggtgcggttatgcgtctgttaacggaa
gcttacgaaaatcgcgaccagattgccctgattcctttccggggtgagcgagcagatgta
ctattgccaccgaccaaatcgattaccctagcgaaaaaacgtctggaaaccctgccctgt
ggtggcggttcccctttagcccacggtttaacccaagcggttcatgtggggatgaatgcc
cgtttatcgggggatatcggtcaagtggtgattgtggcgattaccgacggtagaagtaat
attcctttggcgaaatctttaggcgaaccgattccggagggtgaaaaacccgatattaag
gcagaactgctcgatattgccgctaaaattcgctctttaggcattaaactgctggttatc
gatacggagaaaaaattcgtctccactggttttgccaaagaattagccctaaaagctggg
ggtaaatattatcatctaccccgggccacggaacaagcgatcgcatctatggcgcgaggg
gcaattgcgggactgtag

DBGET integrated database retrieval system