KEGG   Microcystis aeruginosa: MAE_46790Help
Entry
MAE_46790         CDS       T00647                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mar  Microcystis aeruginosa
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAE_46790 (recR)
DNA repair and recombination proteins [BR:mar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MAE_46790 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4302106..4302672)
Genome map
AA seq 188 aa AA seqDB search
MIEQLQKLPGVGPKSAQRLALYILKRPEQDAIELAQAIVAAKKQVGLCQVCFHLSAEPIC
EICRNPNRETGTICVVADSRDVIALEKTREYSGKYHVLGGVISPMDGIGPDQLNIQSLVT
RVSQKKIQEVILAISPSVEGETTTLYIGGLLKPFTKVTRIAFGLPMGGDLEYADEVTLAR
ALEGRREL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagcagttacaaaaattacccggggtgggacccaaaagcgctcaacgtctggcc
ctctatattctcaaacgaccggaacaagatgcgatcgaattggcccaggcgatcgtagca
gcgaaaaaacaagtaggattatgtcaggtttgttttcatctttcggccgaaccaatctgc
gaaatttgccgcaatcctaaccgagaaacggggactatctgtgtggtagctgactccaga
gatgtgattgctttggagaaaacaagggaatattcgggcaaatatcacgttttagggggt
gtcatctcacccatggatgggattggtccagatcaattaaatatacagtctttagtcacc
agagtcagccagaaaaaaattcaggaagttattttagctatcagtcccagtgtcgaaggg
gaaaccacgactttgtatatcgggggtttactgaaacccttcactaaagttacccgtatc
gcttttgggttgccgatgggcggcgatctagaatacgctgatgaagtaactttagcgaga
gctttagaaggtcgtcgggaattgtaa

DBGET integrated database retrieval system