KEGG   Microcystis aeruginosa: MAE_48880Help
Entry
MAE_48880         CDS       T00647                                 

Gene name
chlI
Definition
magnesium protoporphyrin IX chelatase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mar  Microcystis aeruginosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mar00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4479696..4480769)
Genome map
AA seq 357 aa AA seqDB search
MTVTPQAPPKTRRVVFPFTAIVGQEEMKLSLMLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIDVVANDPFNSDPNDPDLMSDEVRQRVDEAIPLTIAKKKVTMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPPLRVKIVEQRAEFDGNP
LSFLEKYNLEQEELQRKLVEAQNLLPSVELDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALAALEGRTTVTVDDIRRVIVLCLRHRLRKDPLESIDSGYKVLKAFNRVFGLEENS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgactccccaagctcctccgaaaactcgccgcgtggtttttcccttcaccgct
attgtcggccaggaagaaatgaaattatccctaatgctcaacgtcatcgaccccaaaatt
ggcggggtgatgattatgggggatcgaggtacgggaaaatcgaccaccattagggcttta
gccgaccttttaccagaaattgacgtagttgctaacgatccctttaattctgaccccaat
gatcccgatttaatgagcgatgaggtgcggcaaagggtggatgaagccattcccttgacc
attgccaagaaaaaagtcactatggtagatctacccctcggtgcgacagaggatcgggtc
tgtggcacaattgacatcgaaaaggccctgtcagaaggggtaaaagcttttgaacctggt
ttgctggccaaagctaatcgcggcattctctatgtggatgaagttaatttacttgacgat
cacctcgtcgatgtgctattggattcggccgctagtggttggaatacggtggaacgggaa
ggaatttccatccgtcacccggcccggtttgttttggtgggatcgggcaacccagaagag
ggagaattgcgcccacaactgctcgatcgcttcggaatgcacgccgagattcacaccgtc
aaagaaccacctctacgggtcaaaatcgtggaacagcgtgcggaatttgatggcaatccc
ctctcgtttttagagaaatacaacttagaacaggaagaactgcaaagaaagctagtggag
gcccaaaatcttttgccttccgtggagcttgattatgatctgcgggtgaaaatttccgag
gtttgttccgagttggacgtggatggattgcgcggcgatatcgttaccaatcgcgccgct
aaagctctggccgctttggaaggacggacaactgtgacggtagatgatatccgtcgggta
attgttctctgtttacgtcaccgtttgcggaaagatccgctagaatcgatcgattctggt
tataaagtcttgaaagcttttaatcgcgtctttggattagaggaaaattcctaa

DBGET integrated database retrieval system