KEGG   Microcystis aeruginosa: MAE_50330Help
Entry
MAE_50330         CDS       T00647                                 

Gene name
desC
Definition
delta 9 acyl-lipid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mar  Microcystis aeruginosa
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mar01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mar01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4609317..4610150)
Genome map
AA seq 277 aa AA seqDB search
MTVATSEKLPIDWVTLIYMAFIHLVALLAFLPSNFSWGAVGVTLILYWITGGLGITLGFH
RLVSHRSFKTPKWLEYFLVFCGTLACQGGAIAWIGLHRIHHKYSDTAPDPHDSNKGFWWS
HMGWMLHEIPADEEIARFTQDIADDPFYKFCQNYFVPIQIVLGLILYAMGGWPFVIWGIF
VRLVLVFHSTWFVNSATHKFGYVSHESHDNSKNCWWVALLTFGEGWHNNHHAYQYSARHG
LQWWEVDLTWMTIRLLQILGLATNIKLPPTTATATES
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcgacttccgaaaaactgcccattgactgggtgactctcatctacatggct
tttatccacttagtggctcttttagccttcttacctagcaattttagctggggtgctgtg
ggagtgacattgattctttattggattaccgggggtttaggaattaccctcggtttccat
cgtttggtctcccatcggagttttaagactcccaaatggttagaatactttctggttttc
tgcgggaccctcgcttgtcaggggggtgcgatcgcatggataggtttacatcgtattcat
cataaatattctgatactgctcccgatccccacgattctaataaaggtttttggtggagt
cacatgggttggatgctgcacgaaattcctgccgacgaagaaatcgctcgttttacccaa
gatatcgccgacgatcctttctataaattctgtcaaaattattttgttcctatccaaatt
gttttaggcttaattctctatgctatgggtggttggccgtttgtaatttggggaattttt
gttcgcttggtcttagttttccactccacttggtttgtcaatagcgccacccacaaattt
ggttatgttagccatgaatcccacgataattctaaaaattgttggtgggttgccctctta
acttttggtgaaggttggcacaataatcaccatgcctatcagtattctgcccgtcatggc
ttacaatggtgggaagttgacctgacttggatgaccatccgtctgctgcaaattctggga
ttagctactaatattaagttgcctcccaccacagcaacggcgacagaaagttag

DBGET integrated database retrieval system