KEGG   Microcystis aeruginosa: MAE_52710Help
Entry
MAE_52710         CDS       T00647                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mar  Microcystis aeruginosa
Pathway
mar00010  Glycolysis / Gluconeogenesis
mar00030  Pentose phosphate pathway
mar00051  Fructose and mannose metabolism
mar00052  Galactose metabolism
mar00680  Methane metabolism
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
mar01120  Microbial metabolism in diverse environments
mar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_52710
   00030 Pentose phosphate pathway
    MAE_52710
   00051 Fructose and mannose metabolism
    MAE_52710
   00052 Galactose metabolism
    MAE_52710
  Energy metabolism
   00680 Methane metabolism
    MAE_52710
Enzymes [BR:mar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MAE_52710
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MAE_52710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAG05093
CYORF: MAE_52710
UniProt: B0JY55
Position
4834252..4835334
Genome map
AA seq 360 aa AA seqDB search
MGEKKRIGILTSGGDCAGLNAAIRAVVHHASGNYGWEVVGIREATNGLISRPPKTTIFDI
EGVDRLLVMGGTILGTTNKGDPFAFPMPDGTLIDRSQEIIDGYHSLGLDALIGIGGDGSL
AILRRIAQQGGINLIGIPKTIDNDVGATEVSIGFDTATNIATEALDRLHFTAASHNRVMI
LEVMGRDAGHIALAAGIAGGAHIILIPEIPYRLEKICEKIRQRQRLDKQFSLIIVSEAVR
TETGNRLVQKEALGEDRLGGIGRYLAEEVARETGAETRVTFLGHIQRGGIPSPMDRLLGA
AFGVAAVALIARGEFDRMVAWQNRQVVSVPIEEAIKTYRVVDPEETLVKTARGLGICLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaaaaaacgaattggaattctcaccagtggtggtgactgtgcgggtttaaat
gccgccattcgtgccgttgtccaccatgccagtggcaattatggctgggaagtggtgggt
attcgagaagcaacgaacggattaattagccgtccccccaaaaccactatctttgatatt
gaaggagtcgatcgcctgttggtgatgggaggaacaattctcggtactaccaataaaggg
gatcccttcgctttcccgatgccggatggaaccctgatcgatcgctctcaggaaatcatt
gacggctatcatagtctgggactggatgccctgatcggcatcggtggcgatggtagtctg
gcgattttgcgccgtattgcccaacagggaggcattaatctgattggtatccccaaaacc
atcgataatgatgtgggagctacagaagtctccatcggcttcgatacagctactaatatc
gccacagaagccctcgatcgcctccattttaccgccgctagtcataaccgggtgatgatt
ctagaagttatgggtagagatgccggccatatcgccctagctgccggtattgcggggggg
gcccatatcattctcattcccgaaattccctaccgattagagaagatctgcgagaagatc
cggcaacggcagcgtctggataaacagttttctctgattattgtctccgaggctgtgcgt
accgaaactggcaatcgcctagtgcaaaaggaagccctaggagaagatcgtctcgggggt
atcggtcgctatttagccgaagaagttgccagggaaaccggggccgaaacgagagtgact
ttcctgggccacattcaacgggggggtattccttctccgatggatcgcttactgggggcg
gcttttggcgtggcggccgtggctctgatcgccaggggagaattcgatcgcatggtggcc
tggcaaaatcggcaagtggtcagtgttcccatcgaggaggcgattaaaacctatcgcgtc
gtcgatcccgaagaaactttagtcaaaaccgccaggggtttgggtatttgtctaggggat
tga

DBGET integrated database retrieval system