KEGG   Microcystis aeruginosa: MAE_52710Help
Entry
MAE_52710         CDS       T00647                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mar  Microcystis aeruginosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAE_52710
   01230 Biosynthesis of amino acids
    MAE_52710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_52710
   00030 Pentose phosphate pathway
    MAE_52710
   00051 Fructose and mannose metabolism
    MAE_52710
   00052 Galactose metabolism
    MAE_52710
  Energy metabolism
   00680 Methane metabolism
    MAE_52710
Enzymes [BR:mar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MAE_52710
Protein phosphatases and associated proteins [BR:mar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MAE_52710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4834252..4835334
Genome map
AA seq 360 aa AA seqDB search
MGEKKRIGILTSGGDCAGLNAAIRAVVHHASGNYGWEVVGIREATNGLISRPPKTTIFDI
EGVDRLLVMGGTILGTTNKGDPFAFPMPDGTLIDRSQEIIDGYHSLGLDALIGIGGDGSL
AILRRIAQQGGINLIGIPKTIDNDVGATEVSIGFDTATNIATEALDRLHFTAASHNRVMI
LEVMGRDAGHIALAAGIAGGAHIILIPEIPYRLEKICEKIRQRQRLDKQFSLIIVSEAVR
TETGNRLVQKEALGEDRLGGIGRYLAEEVARETGAETRVTFLGHIQRGGIPSPMDRLLGA
AFGVAAVALIARGEFDRMVAWQNRQVVSVPIEEAIKTYRVVDPEETLVKTARGLGICLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaaaaaacgaattggaattctcaccagtggtggtgactgtgcgggtttaaat
gccgccattcgtgccgttgtccaccatgccagtggcaattatggctgggaagtggtgggt
attcgagaagcaacgaacggattaattagccgtccccccaaaaccactatctttgatatt
gaaggagtcgatcgcctgttggtgatgggaggaacaattctcggtactaccaataaaggg
gatcccttcgctttcccgatgccggatggaaccctgatcgatcgctctcaggaaatcatt
gacggctatcatagtctgggactggatgccctgatcggcatcggtggcgatggtagtctg
gcgattttgcgccgtattgcccaacagggaggcattaatctgattggtatccccaaaacc
atcgataatgatgtgggagctacagaagtctccatcggcttcgatacagctactaatatc
gccacagaagccctcgatcgcctccattttaccgccgctagtcataaccgggtgatgatt
ctagaagttatgggtagagatgccggccatatcgccctagctgccggtattgcggggggg
gcccatatcattctcattcccgaaattccctaccgattagagaagatctgcgagaagatc
cggcaacggcagcgtctggataaacagttttctctgattattgtctccgaggctgtgcgt
accgaaactggcaatcgcctagtgcaaaaggaagccctaggagaagatcgtctcgggggt
atcggtcgctatttagccgaagaagttgccagggaaaccggggccgaaacgagagtgact
ttcctgggccacattcaacgggggggtattccttctccgatggatcgcttactgggggcg
gcttttggcgtggcggccgtggctctgatcgccaggggagaattcgatcgcatggtggcc
tggcaaaatcggcaagtggtcagtgttcccatcgaggaggcgattaaaacctatcgcgtc
gtcgatcccgaagaaactttagtcaaaaccgccaggggtttgggtatttgtctaggggat
tga

DBGET integrated database retrieval system