KEGG   Microcystis aeruginosa: MAE_54030Help
Entry
MAE_54030         CDS       T00647                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mar  Microcystis aeruginosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mar00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4964288..4966567
Genome map
AA seq 759 aa AA seqDB search
MSIVVSPEQVHQIVNNLHHDPFEVLGAHPLEEEGKVNKWVVRAYLPKTTAAWVILPSQRQ
EYPMTTAYHPHFFECVIDISELNNYQLRIHEGEQERVIYDSYAFRSAKLSDFDLHLFGEG
NHHRIYEKLGAHLAEIEGIKGVYFAVWAPNARNVSIIGDFNNWDGRDHQMRKRNNMVWEL
FIPEIGVGTKYKYEIKNWEGHIYEKSDPYGFAQEVRPKTASIVANLDSYTWDDSDWMEKR
RHSDPLTQPVSVYELHLGSWLHASSAEPPRLLSGEGEAVPVSEWNTGARFLSYYELAQKL
IPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYFAPTSRYGNPEDFMYFVDQCHQNGLGV
LVDWVPGHFPKDGHGLAFFDGTHLYEHGDPRKGEHKEWGTLIFNYGRNEVRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYCRKDGEWVANEYGGRENLEAAEFLRQVNHVIFSYFPG
ILSIAEESTAWPMVSWPTYMGGLGFNLKWNMGWMHDMLDYFGMDPWFRQFHQNNVTFSMW
YNHSENYMLALSHDEVVHGKSNMIGKMPGDEWQKFANVRALFSYMFTHPGKKTMFMSMEF
GQWSEWNVWGDLEWGLLQYEPHQQLKRFFSDLNATYKSEPALYTQDFGQDGFEWIDCSDN
SHSVVSFLRWSKNWQEFLVVVCNFTPQPHSHYRVGVPHPGFYQEIFNSDAGKYGGSNMGN
LGGKWSEEWSYHSRPYSIDLCLPPLGVLVLKISPNASGE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagtggtatcccccgaacaagtccatcaaatcgtcaacaacctccatcacgat
ccctttgaggttttgggggcccatcccctagaagaagaaggaaaagtcaataaatgggtt
gttagagcctatttaccgaaaaccacggccgcttgggttattttaccgtcccaaagacaa
gaatatcccatgacgaccgcttatcacccccattttttcgagtgcgttatcgatatcagt
gaactgaacaattatcaattacgcatccacgagggggaacaggaacgggtaatctatgat
tcctatgccttccgttctgccaaactgagcgattttgatttacacctgtttggggagggc
aaccatcatcgcatttatgaaaaattaggggcgcatttagccgaaatcgagggtattaaa
ggggtttatttcgcagtttgggcccctaatgcccgcaacgtctcgattattggtgatttc
aataactgggatggtcgtgatcaccaaatgcggaaacgtaataatatggtctgggaattg
tttatcccagaaatcggtgttggcactaaatataaatacgagatcaaaaattgggaaggt
catatttacgaaaaatctgatccctacggttttgcccaagaagtacgcccgaaaaccgcc
tcgatcgtggctaatttagatagctatacttgggatgatagcgattggatggaaaaacgc
cgccatagcgatcctttaactcaaccggtttccgtttacgaattacacctcggttcttgg
ctgcacgcttctagtgccgaacccccccgtttactttctggggaaggggaagcggttccc
gtgtcggaatggaacactggggcgcgctttttgagttactacgagttagcccaaaaacta
attccctacgttaaagaattaggttacacccatatcgaattattaccgatcgccgagcat
ccttttgatggttcttggggttatcaagtgacgggttattttgcccccaccagtcgctac
ggcaatcctgaagatttcatgtattttgtcgatcaatgtcaccaaaatggccttggtgtg
ctagtggattgggtccccggtcacttccccaaagatggccacgggttagctttctttgat
ggtactcatctttacgaacacggcgacccgcgcaaaggggaacacaaggaatggggaacc
ttaatttttaactacggtcgcaacgaagtcagaaatttcctcgtcgctaatgctcttttt
tggttcgataagtaccatattgacggcattcgcgtggacgcggtggcttctatgctctat
ctcgattattgtcgtaaagatggggaatgggtggctaacgagtacggtggccgggaaaat
ttagaggcagcggaattcctgcgtcaagttaatcatgtaatttttagctatttccccgga
attctctctattgccgaagaatccaccgcttggccgatggtgtcctggcccacctatatg
ggcggtttaggctttaatttgaagtggaatatgggctggatgcacgatatgctcgattat
ttcggcatggatccctggttccgtcaattccatcaaaataatgtcacttttagtatgtgg
tataaccacagcgagaattatatgctggctttgtcccacgatgaagtggttcacggcaaa
agtaatatgattggcaaaatgccgggggatgagtggcaaaaattcgccaatgtccgggca
ttatttagttatatgtttacccaccccggcaagaaaaccatgtttatgagcatggaattt
ggccagtggagtgagtggaatgtttggggtgatttggagtggggtcttttgcagtacgaa
ccccatcaacagctaaaacgctttttctcagatttgaacgccacctataagagtgaacct
gctttatatacccaggattttggtcaggatggctttgagtggatcgactgtagtgataat
agtcatagtgtcgtttctttcctgcgctggagcaaaaattggcaggagtttctggtggtg
gtctgtaattttactccccaaccccacagccattatcgcgttggtgtaccccatcccggt
ttttatcaggaaatctttaacagcgatgcgggtaaatatggcggtagtaatatgggcaac
ctcggcggtaaatggtcggaggaatggtcctatcatagccgtccctactcgattgatctc
tgtttaccacctttaggggttttagttctcaaaatcagtcctaatgcttctggggaatag

DBGET integrated database retrieval system