KEGG   Microcystis aeruginosa: MAE_54130Help
Entry
MAE_54130         CDS       T00647                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mar  Microcystis aeruginosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAE_54130
Enzymes [BR:mar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MAE_54130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(4974415..4975917)
Genome map
AA seq 500 aa AA seqDB search
MAFSRSSGILLHPTSHPGRYGIGELGREAYQFIDFLAQSGQKLWQILPLGPTGYGNSPYM
SFSAIAGNHLLISLDLLREKNLLSDADLEDIPDFPLDQVDFDKLIAWKIPLLRKAASNFV
KGSDTILYKQFAGFCAGNADWLEDYALFMALSHAYPGKTWMEWPTEIRERHWGALETPKQ
ELQEEIFLHKFLQFEFFEQWLALKRYANSLGIEIIGDIPIYVSHNSADVWANPQVFRLDP
QTGNPLEVAGVPPDYFSETGQLWGNPLYNWDYLKNTGFDWWVRRLKAVLSLVDIIRIDHF
RGLEAYWAVAFGQENAINGRWLKAPGYDLFNTIGARLGKLPIIAEDLGDIDQAVLDFRDH
FAFPGMKILHFAFGGDAGNPYLPFNVERNCVIYTGTHDNNTTVGWFQDNANDYEKARLYQ
YLGAPSGQGVAWDLIRLAYSSVANQAIVPLQDVLGLGSDARMNTPSVAEGNWSWRYRQEA
LTGEYSERLRDLVNLFGRNR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttttagccgttctagcggtattttgcttcatcccaccagtcatcctggccgttac
gggattggagaactaggtagggaagcctatcaatttatcgattttttggctcaaagtggt
caaaaactctggcaaattctccctttaggccccacagggtacggtaactctccctacatg
agttttagtgccattgctggcaatcatctcctgatcagtctcgatcttcttcgggaaaaa
aacctgcttagtgacgcagatttagaggatattcccgattttcccctcgatcaagtggat
tttgataaattgatcgcttggaaaattcccctacttagaaaggcggcgagcaattttgtc
aagggttctgacacaattctttacaaacagtttgccggcttttgtgctggcaatgctgat
tggttagaggattacgccctatttatggctttatcccacgcttacccgggtaaaacatgg
atggaatggccgacagaaattcgcgaacgtcattggggagcgttggaaacaccgaaacag
gagttacaagaggagatttttctgcacaaattcctgcaatttgagttttttgagcagtgg
ttagccttaaaacgctatgctaactccctcggtatcgagattatcggtgatatacccatt
tatgtctcccataatagtgctgatgtttgggcaaatccgcaggttttccgactagatccc
caaaccggtaatcccttggaagtggcgggggttcccccggattatttctcagaaacgggg
caattatggggaaatcctctttataactgggattatctcaaaaatacgggctttgactgg
tgggtacgccgtttaaaagcggttctttccctagtcgatattatccgtatcgatcatttt
cgcggattagaagcctattgggcggtggcttttggccaggaaaacgctattaatggtcgt
tggctgaaggccccgggttatgatctctttaatactattggcgctcgtttaggtaaattg
ccgattattgccgaagatttgggcgatattgaccaagcagtcttagattttcgcgatcac
tttgccttccccgggatgaagattctccactttgcttttgggggtgatgcgggtaatccc
tatcttcctttcaacgtcgaacgcaactgtgtgatttataccggcactcacgataataat
actactgtgggctggtttcaagataacgccaatgactacgaaaaagcgcgactttatcaa
tatcttggcgctcccagtggtcagggagtggcttgggatctgattcgactggcctatagt
tccgtggctaatcaggcgatcgtaccgttacaggatgtgttaggtttaggatcggatgcg
cgtatgaatacccccagtgtcgcagaagggaattggtcatggcgctatcgtcaggaagct
ttaaccggagaatatagcgagagattgcgagatttagtcaatctttttggcagaaatcgt
taa

DBGET integrated database retrieval system