KEGG   Microcystis aeruginosa: MAE_59370Help
Entry
MAE_59370         CDS       T00647                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mar  Microcystis aeruginosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAE_59370 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAE_59370 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MAE_59370 (thrC)
Enzymes [BR:mar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MAE_59370 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5472891..5474000
Genome map
AA seq 369 aa AA seqDB search
MTTISRSIPQSPTKSSSIGGWRGLIEEYRQFLPVSSNTPVITLLEGNTPLIPAPYLSAQI
GRDVKVFVKYDGLNPTGSFKDRGMTMAISKAKEEGAKAVICASTGNTSAAAAAYARRAGM
RAFVIIPDGYVALGKLAQALLYGAEVIAINGNFDDALKIVRQLSENYPVTLVNSVNPYRL
EGQKTAAFEIVDVLGNAPDWLCIPVGNAGNISAYWMGFCQYHQIGKCDRLPKMIGFQAAG
AAPFISKQPVDHPETLATAIRIGNPANWEKAWAASHASQGQFHAVSDEEILAAYRILGGQ
EGVFCEPASAASVAGLLKVHQQVPDGATVVCVLTGNGLKDPDSAVKHSNNQLKSGIAPEL
TQVAQIMGF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacaactatttctcgatcgatcccccaatcacccactaaatcctcgtctatcggcggc
tggcgcggtttgatcgaagaatatcgccaatttctgcccgtaagcagtaacacccctgta
attaccctcctagaaggcaatacacccctgatccccgccccctatctctcagcacaaatc
gggcgcgatgtcaaggtttttgtcaaatatgatggtttaaatcccaccggcagctttaaa
gaccggggcatgaccatggccatctcgaaagctaaggaagaaggggcaaaagcggtgatt
tgtgccagtaccggcaacacctcggcggcggcggcagcctatgcaagaagagccgggatg
cgggcctttgtgattatccccgacggttatgtggccttaggaaaattagcccaggcttta
ttgtacggagcggaagtcatcgctattaatggcaacttcgatgatgccctcaagattgtc
cgccaactatcagaaaattatcccgtaactttagtcaattccgtcaatccctaccgttta
gagggtcaaaaaaccgccgctttcgagattgtcgatgtcttgggtaatgctcccgactgg
ttatgtattcccgtgggtaatgcgggcaatattagcgcctattggatgggattctgtcag
tatcaccagataggcaaatgtgaccgactgccgaagatgatcggttttcaggccgccggg
gccgccccttttatctccaaacaaccggttgaccatcccgaaaccctagccacggctatc
cgtatcggcaaccccgctaactgggaaaaagcctgggccgctagtcacgctagtcaaggg
caatttcacgcggtcagcgatgaggaaatattagcagcctatcggattttagggggccaa
gagggggttttctgtgaaccagccagcgccgcttctgtggcaggattattaaaagtgcat
caacaggttcccgatggggccaccgtagtgtgtgttttaacgggaaatggactaaaagac
ccagattcggcggtaaaacacagcaataatcaactaaaatctgggattgcgcccgaatta
acccaagtggctcaaattatgggcttctaa

DBGET integrated database retrieval system