KEGG   Microcystis aeruginosa: MAE_60270Help
Entry
MAE_60270         CDS       T00647                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mar  Microcystis aeruginosa
Brite
Enzymes [BR:mar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     MAE_60270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5575711..5577225)
Genome map
AA seq 504 aa AA seqDB search
MKVSQNCIDLIKKWEGCKLTAYKCPAGVWTIGIGTTCYPDGRRVREGDKITDQQAEGFLV
NECEEKAKAVDELVNVDLHQNQFDALVSFAYNVGIGAFKESTLRRKLNEKDYEGAANEFK
RWNKATVNGVQVVLEGLTNRRKDEEALFRKNDSFGTPIELEVSPEHSVTWLKGYLDGGNT
VVVAYNDQQVVEVVKLETHLKDDLIDLLQQYPNARNFHLAEPGSPIPQATQIVFAGRNQT
LSLVENPPQLNRGLLLKGMSDEDAPGYDIREMQERLKDLGYYQKELDGIFGSGTDEAVRK
FQADVFGHSEADGKVGPKTWAKLWGEETTPTPTPQPAEGTYLRLTKTNQKDGDGLYILIL
EYIKNGQVKDHLKVCSGQRSKQLFRTGPQSVSGSMEPLPEGKWYINDILWAGGKDKYGPT
VFSNGLGPVTTPIKYVGPNSTRRSAIEIHIDWNGKYCDGPCPGTAGCLGIYDIADYKKLV
SWLRDTNPHDLYVDWGLGTCPQPQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatcacagaactgtattgatctgatcaaaaagtgggaaggttgtaagcttacc
gcttataaatgtcctgctggcgtttggacaattgggattggaacaacttgttatcctgat
ggacgacgtgttcgggaaggggataagattactgatcaacaggcggaaggcttccttgtc
aatgaatgtgaggaaaaagccaaagctgtagatgaattagtaaatgttgatcttcatcaa
aatcagtttgacgctttagtttcctttgcttataacgtaggcatcggagcttttaaagaa
agtaccttacgacgtaaactgaatgagaaggattatgagggggctgccaatgaatttaaa
cgttggaataaagcaacagttaacggagtacaagttgtgcttgaggggttaaccaatcgc
cgtaaagatgaggaagctttattccgtaaaaatgatagttttggaactcctattgagctt
gaagtctctcctgaacattctgtaacttggttgaaaggatatttagatgggggaaataca
gtagttgttgcctacaatgatcaacaagtggtagaggttgttaaactagaaacccatctt
aaagatgatttgatcgatctgttgcaacaatatcccaatgctcggaattttcatcttgcc
gaacctgggagtcctattccgcaagctacacaaattgtattcgcaggtcgtaatcagaca
ctttctctagtggaaaatccacctcaattaaatcgaggactgttactgaaaggcatgagt
gatgaagatgcccccggttatgacatccgagaaatgcaggaacgcttaaaagatttaggc
tattaccagaaagaattggatggtatctttggcagtggcacggatgaggcggtcagaaaa
ttccaagctgacgtttttggtcactccgaagcagatgggaaagtcggaccaaaaacttgg
gctaaattgtggggagaagaaacaacacccacacctactcctcaacctgctgaaggaact
tatctccgactgactaaaactaaccagaaagacggtgatggtttatatattctcattttg
gaatatatcaagaatggacaggtaaaagatcatcttaaagtttgctctggacaacggagt
aaacaactattccgtacaggtcctcaaagtgtatcgggttccatggaaccgctgcctgaa
ggcaaatggtacattaatgacattctctgggcaggtggcaaagataaatatggaccgact
gtttttagtaatggtctgggtccagtgactacccctatcaaatatgtcggaccgaattcc
acacggcgaagtgctattgaaatccatattgattggaatggaaaatattgtgatggtccc
tgtccaggaacggcaggttgccttggtatctacgatattgctgactacaaaaaattagtt
agttggctacgagatactaatccccatgatctatatgtagattggggcctaggaacttgt
cctcaacctcaataa

DBGET integrated database retrieval system