KEGG   Microcystis aeruginosa: MAE_60410Help
Entry
MAE_60410         CDS       T00647                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mar  Microcystis aeruginosa
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mar00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mar00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mar00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5589270..5590163
Genome map
AA seq 297 aa AA seqDB search
MNRLARLRVEDIQAWVGEVHLSDRKGQTAYYIPVLNQVNPEVFALQIHCLEGEILSWGDE
TVTFPLMSVIKPFLLLYLLTHLGEDAVFRRVGKQASSYPFNSLTQLQEDCGFPRNPMINS
GAIALTDLLAGETPESRCENLLLWLNEMGNCQLFLDHSVLDSVHSYPNAHNQALSLELEK
NGYISHRYLALETYNRICCLSGKIADLANLGKLILASSFAEIILEIMTNCGLYEASQQFA
LEVGFPTKSGVSGALLSIVPKQGAIACYSPLLNEQGNSILGLNLLTYISRWMELNIR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgattagctagattaagggtggaagatatacaagcttgggtcggggaagtgcat
ttatcggataggaagggtcagactgcctattatataccggttttgaaccaagttaatccc
gaggttttcgctctccagattcactgtcttgagggggagattttgtcttggggagatgaa
actgtaacttttcctttgatgagtgtgattaaaccttttttgttattatatcttttaact
catttgggggaagatgctgtttttcgtcgcgtgggaaaacaagcttctagttatcctttt
aattccttaactcaactgcaagaggattgcggttttccccgtaatcctatgattaatagt
ggtgcgatcgccttgacagacttattagcaggagaaacgccagaatctcgctgtgaaaat
ttgcttttatggttaaatgaaatgggtaattgtcaattatttctcgatcactctgtgctt
gattctgttcactcctatcctaatgcacacaatcaagctttaagcttagaattagaaaaa
aatggttatatcagtcatcgttatttagccctagaaacctacaatcgaatctgttgttta
tctggaaaaattgccgatcttgctaatttaggtaagttgattttagcttcttcttttgcc
gaaattattctagaaattatgactaattgtggactctacgaagcttcccaacaattcgcc
cttgaggtgggttttcccactaaatcgggagttagtggggccctattatcaattgtaccg
aaacagggagcgatcgcttgttatagtcctctgttaaatgagcaaggtaattcaatttta
ggacttaatttactaacatatataagtaggtggatggaattaaatataagatga

DBGET integrated database retrieval system