KEGG   Microcystis aeruginosa: MAE_61570Help
Entry
MAE_61570         CDS       T00647                                 

Gene name
chlH
Definition
magnesium protoporphyrin IX chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
mar  Microcystis aeruginosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mar00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5701240..5704905)
Genome map
AA seq 1221 aa AA seqDB search
MKSIVLIVGFETFNTNLYRQSGLLASSKCPDLEVKVFSDKSLTSEPEIVEQALATADVFF
ASLIFDYDQVTWLRQRAAQIPIRLVFESALELMSLTRLGEFAIGDKPKGMPKPIQFILSK
FSSGKEEDKLAGYLSFLKTGPKLLKFIPAKKVQDLRNWLIIYGYWNAGGTENVAAMCWII
AQKYLGLKVREIPEVIETPNKGLLHPDYQGYFLTPQEYLTWYKKNKSLDKPVVALLLYRK
HVISKLPYINQLIRHFETANLIPLPVFINGVEGHTIVRDWLTTDYEIQQRKKGIIETPSL
SEDAVTVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKRILSAKNIPYLIAAPLLIQDIYSW
TRQGIGGLQSVVLYALPELDGAIDTIPLGGLVGETIYLIPERLQRLTGRLNSWIKLHKTP
PQERKIAIILYGFPPGYGAVGTAALLNVPRSLVKFLQALQAQGYNVGTIPEDGEEIIQKV
KFADDENLSKQNRLSIETLENWLGYLLTSRIEKQWKSLKDAGIKTIGDQYHLGGIELGNI
WIGVQPPLGIAGDPMRLMFEKDLTPHPQYAAFYQWLQKDFKTDAIIHFGMHGTVEWLPGS
PLGNTGYSWSDILLGDLPNLYIYAANNPSESILAKRRGYGVLISHNVPPYGRAGLYKELM
ILRDLIAEFRENPEKNYALRDSILQKIIDTGISKDCPFLEAEKQGIEFTLENAKLFSRYA
LTDYFVKVYNYLQIVEQRLFSSGLHTLGTAPNQEELKGYLDAYFTDLSEREFQQIIADEA
TNEKVKEGITIKNLLGQNSEELTNLLRGLNGEYVPPAPGGDLLRDGAGVLPTGRNIHALD
PYRMPSPAAYTRGREIAKKLLEQNLTEKGKYPETVAVLLWGLDVIKTKGESLGILLELVG
AEPVKEGTGRIVRYELKPLGEIGHPRIDILANLSGIFRDTFINIIELLDDLMQRAAEIEE
SENDNYIRKHYLALKSQGIDNASARLFSNPAGDFGSLVNDQVVEGNWDNDNELAKTWEKR
NVFSYGRQDKGQARPEVLQQLLKTSESIIQEIDSVEYGLTDIQEYYGNTGGLKLAAEKQS
GKRVMTSFVESFSNDTTPRKLEEVLRLEYRSKLLNPKWANAMVNQGSGGAYEISQRMTAL
IGWGGTANFSDDWVYDQAADTYAFDAEMAEKLRQANPEAFRNIVGRMLEAQGRGFWQADP
DKLEKLQELYQLTDEKLEGVT
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattgttttaattgttggctttgaaacctttaacaccaatttatatcggcaa
tcgggcctgttggctagttctaaatgtcccgatttagaagtaaaagtattcagcgataaa
tccttgacgagcgaacctgaaatagtcgagcaagctttagccactgccgacgtttttttt
gctagtttgatcttcgattacgatcaagttacttggctgcggcaacgagcagcacagatt
ccgattcgcttagtttttgagtctgctttagagttaatgagtttaacccgtttgggagaa
tttgccatcggggataaaccaaaaggaatgccaaaaccaattcaatttatcttgagtaaa
ttttccagtggcaaggaagaagataagttagccggttatctcagtttcctcaaaactggt
ccgaaactgctgaaatttattcccgctaaaaaagttcaagatttgcgtaattggttaatt
atttacggttattggaatgcgggaggaaccgaaaatgttgccgctatgtgttggataatt
gcccaaaaatatctaggattaaaagtacgggaaatacccgaagttatcgaaactcccaat
aagggactattacaccccgattatcagggttattttctcactccccaagaatatttgact
tggtataaaaaaaataaatctcttgataaaccagtggtggcactgctgctttatcggaag
cacgttatcagtaaactaccctatattaatcaattaatccgtcattttgaaacggctaat
ttaattcccctacccgtgtttattaacggagtagaaggccatacaattgttcgggattgg
ttaaccacagactacgaaattcagcaaagaaaaaaaggaatcattgaaactccttcttta
agtgaagatgcggtgacagtagatgcaattgtctcgacgattggctttcctttggtgggg
ggtcctgcgggttctatggaagcaggaagacaggtagaagtggctaaacgaattctgtcc
gctaaaaatattccttatcttatcgctgcccctttattgattcaagatatttattcttgg
acaagacagggaatcggtggtttacagagtgtggttctatacgctttaccggaattagat
ggggcaattgatacaattcctctggggggattagtgggggaaactatatatttaatcccc
gaaagattacagcgtttaactggacgtttaaacagttggattaagttacataaaacccct
ccccaagaacgcaaaatagccatcattctctatggatttccgcctggttatggggcagtt
ggtacggcagctttattaaatgttccccggagtttagttaagtttttacaagctttacaa
gcgcagggttataatgtgggaacaattcccgaagacggggaagaaattattcaaaaagtt
aaatttgccgatgatgaaaatctctctaaacaaaatcgtttatcgatagaaactttagaa
aattggctaggttatctgttaacttctcgcattgaaaaacagtggaaatctcttaaagat
gcggggataaaaactattggcgaccagtatcatttagggggaattgagttaggtaatatc
tggattggagtccagccacctttaggaattgctggggatccgatgcggttaatgtttgaa
aaagatttaactcctcaccctcagtatgcagccttttatcagtggttacagaaagatttt
aagaccgatgcgatcattcattttggtatgcacggaactgtcgaatggctgcccggttca
cccctaggaaatactggttattcttggtcagatattttattaggagatttaccgaattta
tatatttatgccgctaataatccctcggaatctatcctagccaaacgtcgcggttatggg
gtgttaatttcccataatgtgcctccctacggacgagcgggattatataaagaattgatg
attttacgagatttgattgcagagtttcgagaaaatcctgagaaaaattacgctttaaga
gatagtatcctccaaaagattattgatacaggtatctctaaagattgtccttttctggaa
gcagaaaaacagggaatagaattcactttagaaaatgccaaattatttagccgctatgca
ctaaccgattattttgtcaaggtgtataattacctacaaatcgtcgaacaaagactattt
tcttcgggtttacacaccctaggaactgctcccaatcaggaagaattaaaaggttatctt
gacgcttatttcaccgatttatctgagcgagaatttcagcaaattatcgctgacgaagca
accaatgaaaaggttaaagaaggcattactattaaaaatttattaggacaaaatagcgaa
gaattaactaatcttttgcggggattaaatggggaatatgtaccaccggcaccggggggg
gatttactccgggatggtgcgggagttttgcccacaggacgtaatatacacgctttagac
ccttaccggatgccttccccagcagcctacacccgcggacgggaaatcgccaaaaaactg
ctagaacaaaacttaaccgaaaaaggaaaatatcccgaaactgtagcagttttactctgg
ggattagatgtgattaaaactaagggtgaatccctgggtattctcttagaattagttggt
gcggaaccagtgaaagagggaacaggaagaattgtcaggtatgaattaaaacctctaggg
gaaattggacacccgcgcatcgatattctggctaatttatcgggaatttttcgggatact
tttatcaatattatcgagttattggatgatttaatgcagcgggcagccgagatagaagaa
tcggaaaatgataattatatccgtaagcactatttagccttaaaaagtcaaggaattgac
aatgcgagcgctcgtttattttccaatcctgccggggattttggctctttagttaatgac
caagtagtggagggaaattgggacaatgacaacgaattagcgaaaacttgggaaaagcgt
aatgtttttagttatggtcgtcaagataagggacaagcgcggccagaagtgctacaacag
ttattaaaaaccagtgaaagtattatccaagaaattgactcggtagaatacggtttaacc
gatattcaggaatactacggcaacacgggaggattaaaattagccgcagaaaaacaaagc
ggtaaacgggtaatgacaagttttgtcgagagtttttccaatgatacaactccccgcaaa
ttagaggaggttttgcgcttagaataccgcagtaaattactcaatcctaaatgggccaat
gccatggttaatcaaggttccggtggggcctacgaaatctcccaaagaatgaccgcttta
attggttggggcggtacggctaattttagtgacgattgggtgtatgatcaggcagccgat
acctacgcttttgatgcagaaatggcggaaaaattgcgtcaagctaatcccgaagctttc
cgtaatattgtcggtagaatgttagaagcacagggtcgcggtttttggcaagcagacccc
gacaaattagagaaattacaggaattatatcaattgaccgatgaaaaattagaaggggtt
acttag

DBGET integrated database retrieval system