KEGG   Marinilactibacillus sp. 15R: BKP56_03625Help
Entry
BKP56_03625       CDS       T04573                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
marr  Marinilactibacillus sp. 15R
Pathway
marr00071  Fatty acid degradation
marr00072  Synthesis and degradation of ketone bodies
marr00280  Valine, leucine and isoleucine degradation
marr00310  Lysine degradation
marr00362  Benzoate degradation
marr00380  Tryptophan metabolism
marr00620  Pyruvate metabolism
marr00630  Glyoxylate and dicarboxylate metabolism
marr00640  Propanoate metabolism
marr00650  Butanoate metabolism
marr00900  Terpenoid backbone biosynthesis
marr01100  Metabolic pathways
marr01110  Biosynthesis of secondary metabolites
marr01120  Microbial metabolism in diverse environments
marr01130  Biosynthesis of antibiotics
marr01200  Carbon metabolism
marr01212  Fatty acid metabolism
marr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:marr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKP56_03625
   00630 Glyoxylate and dicarboxylate metabolism
    BKP56_03625
   00640 Propanoate metabolism
    BKP56_03625
   00650 Butanoate metabolism
    BKP56_03625
  Lipid metabolism
   00071 Fatty acid degradation
    BKP56_03625
   00072 Synthesis and degradation of ketone bodies
    BKP56_03625
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKP56_03625
   00310 Lysine degradation
    BKP56_03625
   00380 Tryptophan metabolism
    BKP56_03625
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKP56_03625
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKP56_03625
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BKP56_03625
Enzymes [BR:marr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKP56_03625
Exosome [BR:marr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKP56_03625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: API88444
UniProt: A0A1L4BXA7
Position
746248..747465
Genome map
AA seq 405 aa AA seqDB search
MQKVYIAGAKRTPIGSFLGALKDVSAADLGKTAIQGVLNQSGVDPTDIDEVSLGNVLSAG
QGQGVSRQASIKAGIPETTPAYGTNMVCGSGLKTVMNAFIGIRAGEYNTVVAGGTESMSQ
APYLIPNRARTGIKMGGFQAIDHMVHDGLTDAFEGYHMGVTAENIAEQYGISREDQDAFA
FDSQKKSLEALDNGLFKEEVVPVEYTTRRKEQVIVDADEYPNRKANLEKMSSLRPAFKKE
GTVTAANASGLNDGASATLIVGEDYLQEKSIQPLAEIVAIGQGGVDPSIMGMGPVPAIKQ
TLKKSGLSFGDIDVFELNEAFASQSLAVVHELSEAFKIDKETLIAKTNMSGGAISLGHPI
GASGNRILVTLLYTLKRKGLKYGIASLCIGGGMGAAVIIRNTDID
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtatatatagcaggggcaaagcggacgccaatcggttcgtttcttggtgca
ctgaaagatgtttcagctgctgacttaggaaaaacagctatccaaggcgttttaaaccaa
agtggtgttgatccaactgacatagatgaagtatctttaggaaacgttctttcagctggt
caaggtcaaggtgtttccagacaagcttctatcaaagccggtattccagaaactacgcca
gcttatggaacaaatatggtctgtgggagtggcttgaaaactgtcatgaatgcttttatt
ggcattcgtgcgggagaatataatacagttgtggctggtgggacagaatctatgagccaa
gccccttatcttattcctaacagagctcggactggtatcaagatgggaggttttcaggcg
atagaccatatggtgcatgatggattgacagatgcttttgagggttatcatatgggggtt
actgcggaaaatattgccgaacagtatggaatctcacgtgaagatcaggacgcctttgca
tttgattcccagaaaaaatcgctcgaagcactggataatggtttatttaaagaagaagtg
gttcctgtagagtatacaactagaaggaaagaacaggttattgttgatgctgatgaatat
cctaatcgtaaagcgaatcttgaaaaaatgagttcactcagaccagcgttcaaaaaagag
ggtacggtaacagctgcaaatgcttctggactgaatgatggtgccagcgcaacgttgatt
gttggagaagactatctgcaagaaaaatctattcaaccattagctgaaattgtcgcaatt
ggacaaggcggcgttgatccatcgattatggggatgggacctgttccagccattaagcaa
acattgaagaaatctggactatcttttggtgatatagatgtatttgaattgaatgaagcc
tttgcttctcaaagtttagcggtagtgcatgaattgtctgaagcgttcaaaatagacaaa
gaaacactaattgctaaaacaaatatgagcggtggtgccatttccctcggtcatcccatt
ggagcaagtggaaatcgcattttagttactttgctgtatacattaaaacgcaaaggattg
aaatatggaatagcttctttatgtattggtggcggcatgggtgcggctgttattatcaga
aatacagatattgactaa

DBGET integrated database retrieval system