KEGG   Mahella australiensis: Mahau_0163Help
Entry
Mahau_0163        CDS       T01494                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
mas  Mahella australiensis
Pathway
mas03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mahau_0163
DNA repair and recombination proteins [BR:mas03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Mahau_0163
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mahau_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 IMS_HHH HHH_8 HHH_3 Cdd1 Toprim_2 DZR
Motif
Other DBs
NCBI-ProteinID: AEE95386
UniProt: F3ZWF1
Position
173211..173810
Genome map
AA seq 199 aa AA seqDB search
MNYYAEPISRLINELSKLPGIGPKTAQRLAFYMLHMPKDAVHTLAQSINDARDKIIYCSI
CGNLTDVDPCAICSSSTRDNSTICVVESPTDVVAMEKTRGYNGLYHVLHGAISPIDGVGP
DDIRIKELLTRLRDSQVKEVILATNPSVEGEATALYISRMLKPMGFKVTRIANGIPVGGD
LEYADEVTITRALEGRREM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaattattatgctgaaccgatttcgcgtctgataaacgagctttcgaagctgcctggt
atagggcctaagaccgcgcagaggctggctttttatatgctgcatatgcccaaagacgcc
gtacacaccctggcccagtcgataaacgatgcgcgggataagataatatactgttctata
tgcgggaacttgaccgatgtggacccatgcgcgatatgcagcagctctacccgcgataac
agcacgatatgcgtcgtagagagccctaccgatgtagtggctatggagaagacgcgaggg
tataacgggctttaccatgtattgcacggtgcaatatccccgatagatggcgtaggccct
gacgacatacgcataaaggagctgttaacccgtttacgcgacagccaggtaaaagaggtc
atactggccacaaatcccagcgtggaaggggaggccacggccctctatatatcgcgcatg
ctcaagcccatgggttttaaggtaacgcgcatagccaacggcataccggtgggcggcgac
ctggagtatgccgatgaggtgactataaccagggcattggaaggacgccgcgagatgtaa

DBGET integrated database retrieval system