KEGG   Mahella australiensis: Mahau_0265Help
Entry
Mahau_0265        CDS       T01494                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mas  Mahella australiensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mahau_0265
  Amino acid metabolism
   00340 Histidine metabolism
    Mahau_0265
Enzymes [BR:mas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mahau_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
290633..291925
Genome map
AA seq 430 aa AA seqDB search
MINFIDLRKQNKNDFIARLRSRSQLSRDDIKALVELIVQDIRDRGDNALLEYEKRFDHVD
MLPDSIKVAQYEIDDAYAKVEPRFIEVIKKAAENIRVFHSKQLDKSWMVNGENGTIMGQI
YRPLECAGIYVPGGRAAYPSSVLMNAIPAQVAGVQRIIMATPPMEDGSVYPYTLVAAKEA
GVNEIYRMGGAQAVAAMAFGTDAVPRVDKIVGPGNIYVAMAKRAVYGYVDIDMIAGPSEI
LIIADSSADPAFIAADLLSQSEHDPMASSILITDDDGLAAKVADEVEKQSAELSRRDIIA
QSMSYYGYIILVRDMREAVRLANDIAPEHIELMVSQPFEMLSGIKNAGSIFLGRYSPEPL
GDYMAGPNHVLPTGGTARFYSPLSVDDFIKKSSFIYYSEGALSAIKDDIIDLAQFEGLTA
HANSVRVRFE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgataaacttcatagatttgagaaagcagaataaaaacgacttcatagcccgtttgcgt
tcgcgctcgcagcttagccgcgacgacataaaagccttggtcgagctcatagtgcaggat
atacgcgacaggggcgacaatgctctgctggaatacgagaagcgctttgaccacgtggac
atgttacctgattcgatcaaagtggcgcagtatgaaatagacgatgcttacgctaaggta
gagccgcgttttatagaggtcataaaaaaagccgctgaaaatataagggtatttcacagc
aaacaactcgataaatcgtggatggtaaacggcgagaacggcactataatgggccagatc
tatcgtccattggaatgcgcaggcatatatgtgccgggtggccgcgcggcctatccgtcg
tcggtgctcatgaacgctataccggcacaggtggcaggagtgcagcgtataataatggcc
acgccacctatggaggatggcagcgtgtatccatatacgctggtagccgctaaagaggcc
ggcgtgaatgagatataccgtatgggcggggcgcaggctgtagccgctatggcatttggt
accgacgctgtgcccagggtggataagatagtagggccgggcaatatatatgttgccatg
gccaagcgcgcagtgtatggatatgtcgatatagacatgatagccgggccgagtgaaata
cttattatagccgacagcagcgccgaccctgcgtttatagcggccgatctgctgtcgcag
agcgagcacgaccccatggcatcgtcgatactcataaccgacgacgatggattggctgcc
aaggtggctgacgaggtggaaaaacaaagcgctgagctctcgcgccgcgatatcatagcg
caatccatgtcctattatggttatataatacttgtgcgggatatgagggaggcagtgcga
ttggccaatgatattgcgcccgagcatatagagcttatggtcagccaaccgtttgaaatg
ttgagcggtataaaaaacgctggttcgatatttttaggccgatattcccccgagccgctg
ggcgattatatggcagggcccaatcatgtgttgcctaccggcggtacagcgaggttttat
tccccgctcagcgtcgacgactttataaagaaatccagctttatatattattccgaaggt
gcgttatctgctataaaggatgatataatagatttggcacaatttgaagggcttacggcc
catgccaattcggtgagggtgaggtttgaatga

DBGET integrated database retrieval system