KEGG   Mahella australiensis: Mahau_0466Help
Entry
Mahau_0466        CDS       T01494                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mas  Mahella australiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mahau_0466
Enzymes [BR:mas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mahau_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516282..517283
Genome map
AA seq 333 aa AA seqDB search
MKKSIILYIIVLSLIFMTACNDGNTERSVFGMRRGINIGNALEAPNEGEWGVTVKDEYFK
IIKDAGFDTVRIPIKWSAHAMADPPYTIDKAFFDRIDHLVNQSLEQKLCTIINIHHFDEL
VKDPEAQKERFLSIWQQIAEHYKNYPDKLYFEILNEPNGALDQYWNDYLAEAVEVIRKSN
PDRILIAGPGNWNGISALENFEIPEDDKNIIVTFHYYNPFWFTHQGAEWVNPSPPVGKEW
EGTDDQKQFIEDEILKAVDWAKEHNRQLFMGEFGAYSKADMESRAKWTSFVARTAEKYDI
AWAYWEFCSGFGAYDPVLNQWREPLLQALVPSE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagtataatcttatatataatcgttttatcgcttatttttatgacggcctgt
aacgatggtaatacagaaaggagtgtattcggcatgaggagaggcataaatataggaaat
gcccttgaggcccctaatgaaggagaatggggtgtcactgtaaaggatgaatattttaaa
ataataaaggacgctggatttgatacggtgagaatacctataaaatggtcagcgcatgct
atggctgatccaccatatactatagataaggccttcttcgataggatagaccatctagta
aatcaatcgcttgagcaaaagctctgtactataataaatatacatcatttcgacgagctg
gttaaggatccggaagcccagaaagagcggtttttaagcatttggcagcagatagccgag
cattataagaattatccggataagctttatttcgaaattttaaatgagcccaacggagca
ttggaccaatactggaacgattaccttgcagaagcggtagaggtgataagaaagagcaac
cctgacaggatactgatagcagggccggggaattggaatggtatatcagcgttggaaaat
ttcgagattccagaagatgataaaaatattatagttacattccattattataatccattt
tggtttacacaccagggggcagagtgggtcaatccatccccgcctgtcggcaaagaatgg
gaaggaaccgatgaccaaaagcaatttatagaggatgagatacttaaggctgtcgactgg
gcaaaagagcataacaggcagcttttcatgggcgagtttggagcatacagtaaagcggat
atggaatcgagggcaaagtggacgtcgttcgtagcccgcacggcagaaaaatatgacata
gcatgggcctattgggagttctgctcgggctttggcgcatatgaccccgtgcttaaccag
tggagggaaccgctgctgcaagcattggttccgtctgaataa

DBGET integrated database retrieval system