KEGG   Mahella australiensis: Mahau_0468Help
Entry
Mahau_0468        CDS       T01494                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mas  Mahella australiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
517526..518668
Genome map
AA seq 380 aa AA seqDB search
MRKKIHGTIIVYCMFLTLLFTGCGSVPVKSNDQAKPNKDEEETDMIEEVPSLKEVYKDYF
YIGAAISVDSVSKSPDKELIAKQFNIITPENAMKFEPIHPQDGIYNFEPADKIVEFAQRN
DMKVIGHTLIWHNQTPDWVFKDADGNQVDRDVLLKRMEEHIKAVVGHYKGKVYGWDVVNE
AIEDTAPYGLRDSMWKKIIGDDYIEWAFKFAHEADPDAELYYNDYNTETPGKREAIYNLV
KSLKGKGIRIDAVGMQSHINIYYPSVQEIEESIKKFSSLGVKVNISELDMDLYKWDEKED
RYKDGVPDDILKLQADRYGEIFALYRNYKDVIGRVTFWGYYDGGSWLNDFPIKGRTNYPL
LFDREFKPKPAFWNVAKFAQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagaaaattcacggtactattatagtatattgcatgtttttaacgcttttgttt
actggatgtggcagtgtacctgtaaaaagcaatgatcaagcaaaacccaataaggatgag
gaggaaacagatatgatagaggaagtaccgtcattaaaagaggtttataaagactatttt
tatataggcgccgctataagcgttgattcagtgtcaaaaagccctgataaagagcttata
gccaagcagttcaatataattaccccagagaatgctatgaagtttgaaccgatacatcct
caggatggcatatataattttgaaccggctgataaaatcgttgaatttgcccagcggaac
gacatgaaggtgataggccatacgctcatatggcataatcagacgccagactgggtgttt
aaagatgcggatggtaaccaggtcgatcgcgatgtgctcttaaagagaatggaagaacat
ataaaagcagtagtggggcattataaaggcaaagtatatggctgggatgtggtgaatgaa
gctatagaagatactgccccgtatggtttgagagatagcatgtggaaaaagattataggc
gacgattatatagaatgggctttcaagtttgctcatgaggctgatccggatgccgagctg
tactataacgattataataccgagacgccaggtaaaagagaggcgatatataatcttgtt
aaaagtcttaaaggaaaaggtatccgcatagatgccgtcggtatgcagtcccatataaat
atatattatccctctgtgcaagaaatagaggaatccataaaaaaattctcttcgctgggc
gtaaaggtaaatataagtgaactcgatatggatctatataaatgggatgaaaaagaagac
aggtataaagacggcgtccctgacgatatattgaaactacaggccgatagatatggagag
atattcgctttgtataggaactataaggatgttataggacgggtgacattctggggttac
tatgatggtggttcatggctgaacgatttcccgataaaaggcaggaccaattatccgtta
cttttcgatagagaatttaagcccaagccggctttttggaatgtggcgaaattcgcgcaa
tag

DBGET integrated database retrieval system