KEGG   Mahella australiensis: Mahau_0523Help
Entry
Mahau_0523        CDS       T01494                                 

Definition
methionyl-tRNA synthetase (EC:6.1.1.10)
Orthology
K01874  
methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mas  Mahella australiensis
Pathway
Selenocompound metabolism
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:mas00450]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:mas00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
573316..574854
Genome map
AA seq 512 aa AA seqDB search
MSKDKTYYITTPIYYPSDKLHIGHSYTTVAADAMARFKRMTGYDVWFLTGTDEHGEKIER
VARQHNVTPQQYVDDIVSWIKNLWETMDISYDQFIRTTDPEHMKIVQTIFNRLYEQEDIY
KGEYEGWYCTPCEAFWTELQLVNGKCPDCGRPVERVREEAYFFKLSKYQDRLIEYIETHP
DFIQPASRRNEMLNNFLRPGLEDLCVSRTSFSWGIPVTFDPKHVIYVWIDALSNYITALG
AFTDHDEAFRKYWPADVHLVGKEIVRFHTIIWPAILMALGLELPKQVFGHGWLVMDGGKM
SKSKGNVIDPLKLVEQYGVDAVRYFLLREVPFGADGNFSNEALVNRINSDLANDLGNLVS
RTVAMVEKYFGGVLPVPSTAQSMDDGLKSMALSTPKKMEELMDKLQFSNALSEIWALVAR
SNKYIDETMPWVLARDEAQKERLGTVLYNLTEVIRMISVMIQPYMPNTSPMIWRQIGLAE
GPTTSWQSLYDFGAIEPGTMVKKGPALFPRIQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggataaaacctattatataactacacctatatattatccgagcgataaactg
catatagggcattcctatactacagtggcggctgacgctatggcgcgctttaagcggatg
accggctatgatgtgtggtttctgaccggcaccgacgagcacggcgagaagatagagaga
gtggccaggcagcataacgtgacgccgcagcagtatgtggatgatatagtatcatggata
aaaaatctgtgggaaacaatggatatatcatatgaccaattcatacgtactacagaccca
gaacatatgaagatagtgcagactatattcaaccgcctttatgagcaggaagatatatat
aagggcgagtacgagggctggtattgtacgccgtgcgaggcattctggactgagctgcag
ttggttaacggcaaatgtccggactgcggcaggccggtggagagggtgcgcgaggaagct
tacttttttaagctctcaaagtaccaggatagattgatagagtatatagaaacccatcct
gattttatacagcctgcatcgcggcgaaatgagatgttgaataattttctgcgcccagga
ttagaggatttgtgcgtatcgcgtacatctttcagctggggtatcccggtgaccttcgat
cctaagcatgtaatatacgtttggatagatgctctcagcaactatataacagcactgggc
gcgtttaccgatcatgacgaggcatttcgaaagtattggccggctgatgtgcatttggta
ggcaaggaaatagtgcgctttcatactataatatggcctgccatattgatggctttgggt
ctagagcttcccaaacaggtatttggccacggatggctggtcatggatggcggtaagatg
tccaagtcaaaaggcaatgtaatagatccgctcaaattggtcgaacagtacggcgtagat
gctgtgcgctatttcctgctgcgcgaggtaccatttggggcagacggtaatttttcaaac
gaagcgctggtcaatcgtataaattccgatctggccaatgatctgggcaacctggtcagc
cgtacggtagctatggtggagaaatattttggtggcgtgttacctgtgccctctactgct
caatctatggacgacggcttaaaatccatggctttgagtaccccaaagaaaatggaggag
ctgatggataaactccaattcagtaacgccttgtcggagatatgggcacttgtcgcccga
agcaataaatatatagatgaaaccatgccgtgggtattagccagggacgaagcacaaaag
gagcgtttgggtaccgtgctctataatctgaccgaggtcatacgcatgatatccgtcatg
atacaaccgtatatgcccaacacatcgcccatgatatggagacaaataggacttgccgaa
ggcccaactacatcctggcagagtttatacgattttggcgcaatagaacccgggacaatg
gtcaaaaagggtccggcgctattcccgaggatacaatag

DBGET integrated database retrieval system