KEGG   Mahella australiensis: Mahau_0532Help
Entry
Mahau_0532        CDS       T01494                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mas  Mahella australiensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mahau_0532
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mahau_0532
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mahau_0532
Enzymes [BR:mas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mahau_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
581769..582953
Genome map
AA seq 394 aa AA seqDB search
MNKGRFGRFGGQYVPETLMNALDELERAYNEAMADNSFMEELGYYLDKYVGRPTPLYFAE
RLTEYLGGGKVYLKREDLNHTGAHKINNALGQGLLAKRMGKKRLTAETGAGQHGVAAATA
AALLGMECDVFMGREDMERQALNVFRMELLGARVVPVTSGTATLKDATNEAIRDWVSNVE
HTHYIIGSVVGPHPYPTMVRDFQRIIGDETRQQIIQAEGCLPDHIIACVGGGSNSMGIFY
PFVSDDVVKLYGVEAAGLGLDTDKHAATISKGNVGVLHGMMTYLLQDKYGQIQPVYSISA
GLDYPGVGPEHAYLYDIGRVHYTSVTDNEAVEAFEMLSRLEGIIPALESAHAVAYAAKLV
PQLSKDDIIVINISGRGDKDVQSIAKLKGVNIDE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggacgttttgggcgttttggcgggcaatatgtgcccgagacgcttatgaat
gcgctggacgaactggagagggcatataacgaagccatggccgacaattcattcatggaa
gaattaggttattatttggataaatatgtaggcaggccgacgccgttgtatttcgctgag
cggcttacagaatacctgggtggtggcaaggtatatcttaaacgcgaagacttgaaccat
acaggcgcacacaagataaacaatgcattgggtcaggggctattggccaagcgcatgggg
aaaaagagactgacggctgaaacaggcgccggacagcatggcgtggctgcagctacggcg
gcagcgcttttgggcatggagtgcgatgtgtttatggggcgcgaggatatggagcgacag
gccctgaacgtatttcgcatggaattgctgggggccagggtggtacctgtaacctccggt
acggctacattaaaggatgctaccaatgaagccatacgcgattgggtatcaaatgtggag
catacgcattatattataggctctgtggtaggaccacatccatatccgaccatggtacgc
gattttcagcgtattataggcgatgaaaccaggcagcagataatacaagccgaagggtgc
ctgcccgaccatattatagcctgtgtaggcggcggcagtaattccatgggtatattttat
ccgtttgtaagcgatgatgtagtcaagttatatggtgtggaagcagccggtctgggcctc
gataccgataaacatgcggctactataagcaagggcaacgtgggagtgttgcatggcatg
atgacgtacttattacaggataaatacggccagatacagcccgtttattccatatccgcc
ggtttggattatcctggagtgggtccggaacatgcatacctgtatgatatcggacgtgtg
cattatacttccgtcaccgataatgaagcggtcgaggctttcgagatgttgtctcgcctg
gaggggataatacctgctctggagagcgctcatgcggtggcgtatgccgcgaagctggtg
ccccagctatccaaagacgatatcatagtgataaatatatcgggcagaggggataaagac
gtacaatccattgccaaattaaagggggtaaacatcgatgaatag

DBGET integrated database retrieval system