KEGG   Mahella australiensis: Mahau_0533Help
Entry
Mahau_0533        CDS       T01494                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mas  Mahella australiensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mahau_0533
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mahau_0533
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mahau_0533
Enzymes [BR:mas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mahau_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
582946..583758
Genome map
AA seq 270 aa AA seqDB search
MNRIDERFDELRRHGKKALIPFITAGDPDVKYTMDAVRALESAGADIIELGIPYSDPLAD
GPVIQASSQRSLKGGMNLDIAFDMVQNLRVNTSIPLVFLIYYNCIYQYGLEKFIEQCGKT
GVDGAIVPDLPYEERQALKPLLDDAPVYFISMVAPTSAQRIKEIASSAKGFLYCVSSLGV
TGERQAFDSNIDAFMEKVNLYSVVPTALGFGISEPQHMRRLGYLADGLIVGSALVRRIEQ
KASDRDIYEFMRGLRMALDECMEQTMENNS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaataggatagatgagcggtttgacgagctaagacggcatgggaagaaggcgctgata
ccgtttatcacagccggggatccagatgtgaaatatacgatggatgccgtcagggcctta
gaatcggctggcgccgatataatagagcttggcataccgtattccgacccattggccgat
ggaccggtgatccaggcatcatcgcagcgctccttaaaaggtgggatgaacctggacata
gccttcgatatggtgcaaaaccttcgtgtaaatacttccattcctttagtgtttttgata
tactataactgtatatatcaatatgggttggagaaattcattgaacaatgcggtaagaca
ggcgtggatggtgcgatagtacccgatctgccttatgaagaacgccaggcgttaaagcca
cttttggatgatgcgccggtatactttatatccatggtggcgccgacgtcagcgcagcgt
ataaaggaaatagcctcgagtgccaagggctttttgtactgtgtatcatcgctgggggtg
acgggcgagagacaggctttcgacagcaatatagacgcctttatggaaaaggtaaatcta
tacagcgtggtgcccacagccctaggctttggcatatccgagccgcaacatatgcgccgc
ttggggtatttggccgacggcctcatagtgggcagcgcattggtacggcggatagaacaa
aaagcctccgatcgagatatatatgaatttatgaggggattgaggatggctctcgatgaa
tgtatggaacagactatggagaataatagttga

DBGET integrated database retrieval system