KEGG   Mahella australiensis: Mahau_0533Help
Entry
Mahau_0533        CDS       T01494                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mas  Mahella australiensis
Pathway
mas00260  Glycine, serine and threonine metabolism
mas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mas01100  Metabolic pathways
mas01110  Biosynthesis of secondary metabolites
mas01130  Biosynthesis of antibiotics
mas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mahau_0533
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mahau_0533
Enzymes [BR:mas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mahau_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA DUF3583
Motif
Other DBs
NCBI-ProteinID: AEE95737
UniProt: F3ZZC7
Position
582946..583758
Genome map
AA seq 270 aa AA seqDB search
MNRIDERFDELRRHGKKALIPFITAGDPDVKYTMDAVRALESAGADIIELGIPYSDPLAD
GPVIQASSQRSLKGGMNLDIAFDMVQNLRVNTSIPLVFLIYYNCIYQYGLEKFIEQCGKT
GVDGAIVPDLPYEERQALKPLLDDAPVYFISMVAPTSAQRIKEIASSAKGFLYCVSSLGV
TGERQAFDSNIDAFMEKVNLYSVVPTALGFGISEPQHMRRLGYLADGLIVGSALVRRIEQ
KASDRDIYEFMRGLRMALDECMEQTMENNS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaataggatagatgagcggtttgacgagctaagacggcatgggaagaaggcgctgata
ccgtttatcacagccggggatccagatgtgaaatatacgatggatgccgtcagggcctta
gaatcggctggcgccgatataatagagcttggcataccgtattccgacccattggccgat
ggaccggtgatccaggcatcatcgcagcgctccttaaaaggtgggatgaacctggacata
gccttcgatatggtgcaaaaccttcgtgtaaatacttccattcctttagtgtttttgata
tactataactgtatatatcaatatgggttggagaaattcattgaacaatgcggtaagaca
ggcgtggatggtgcgatagtacccgatctgccttatgaagaacgccaggcgttaaagcca
cttttggatgatgcgccggtatactttatatccatggtggcgccgacgtcagcgcagcgt
ataaaggaaatagcctcgagtgccaagggctttttgtactgtgtatcatcgctgggggtg
acgggcgagagacaggctttcgacagcaatatagacgcctttatggaaaaggtaaatcta
tacagcgtggtgcccacagccctaggctttggcatatccgagccgcaacatatgcgccgc
ttggggtatttggccgacggcctcatagtgggcagcgcattggtacggcggatagaacaa
aaagcctccgatcgagatatatatgaatttatgaggggattgaggatggctctcgatgaa
tgtatggaacagactatggagaataatagttga

DBGET integrated database retrieval system