KEGG   Mahella australiensis: Mahau_0704Help
Entry
Mahau_0704        CDS       T01494                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mas  Mahella australiensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mahau_0704
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mahau_0704
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mahau_0704
Enzymes [BR:mas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mahau_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747768..748817
Genome map
AA seq 349 aa AA seqDB search
MWKGLIDRYRDYLPVNDATPVITLNEGDTPLIKAHNIEKELGGIELYLKYEGLNPTGSFK
DRGMTMAISKAAEEGSNTVMCASTGNTSASAAAYAARAGMRCIVLIPNNKIALGKLAQAM
AYGAEIVAIDGNFDQALQLVREITSSHPITLVNSINPFRIEGQKTGAFEVCDQLEGAPAY
LAIPVGNAGNITAYWKGFKQYYEGGVISVLPKMLGFQAAGAAPIVENRVIEHPETIATAI
RIGNPASWKGASNAITESEGHIDKVTDDEILEAYKLLASAEGVFAEPASCASVAGVIKLS
RRGFFKRGQRVVCILTGNGLKDPDTAISLGGQPKVWPADLKVLERELLA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatagatagatacagagattatttgccggtaaacgatgctacgccg
gttataacactgaatgaaggcgatacgccgcttataaaggcgcataatatagagaaagaa
ttgggtggcatagagctttatctgaaatatgagggattaaatcctaccggttcatttaaa
gataggggaatgactatggctatatccaaagctgcagaagaagggtctaataccgttatg
tgcgcctctaccggcaatacgtcggcatctgcagctgcttatgcggccagggctggtatg
cgctgcatagtgcttatacccaataataaaatagcattgggcaaattagctcaagcaatg
gcatatggtgcggaaatagtggctatagacggtaatttcgaccaagcattgcagctggta
agagaaataacttcatcacatcccataacgcttgtaaattccataaacccgttccgcata
gaaggccaaaagacgggggcattcgaggtatgtgaccaactcgagggggcaccggcctat
ttggcaataccggttggcaatgccggcaatataacagcttattggaagggatttaaacaa
tattatgaaggcggagttataagtgtgcttcctaaaatgttgggttttcaagcggccggt
gcagcgcctatagtggagaatagggtaatagagcatccagagaccattgcaacggctata
cgtataggtaatccggctagttggaagggagcaagcaatgctataacggaatccgagggc
catatagataaagtaaccgacgatgagatacttgaagcttataagctactggcgagtgcc
gaaggcgtatttgcagagcctgcatcatgcgcttctgtggcaggtgttataaaattatca
cgccgtggatttttcaagagaggtcagcgcgttgtctgtattttgacgggcaacggttta
aaagatccagatactgctataagcttaggcggtcagcctaaagtatggccagctgattta
aaggtattggaacgagaactgctcgcttaa

DBGET integrated database retrieval system