KEGG   Mahella australiensis: Mahau_1113Help
Entry
Mahau_1113        CDS       T01494                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mas  Mahella australiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mas00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152391..1153671
Genome map
AA seq 426 aa AA seqDB search
MNKRKMLAFMIAIVLILSSLMTSTIVVRKTEAAASSIVASHGMLKVVGNKVCDASGKPIQ
LKGMSLFWSQWSTPFWNADLVNNLASTWNATLIRAAMGVDEGGYISNPQVEKQKVITVVD
AAINAGIYVIIDWHSHDIHTSEAVAFFGEMAQRYKNTPNVIFEIFNEPDYESWAQVKTYS
TQVINTIRSTGAQNLILVGSPTWSQDVDVAANDPITGFSNIAYTLHFYAGTHKQYLRDKA
ITAMSKGLALFVSEWGTCDASGNGNLDLTESQRWIDFMNQYQISWANWSMNDKAETASAL
VVGASTTGPWPDSQLTESGKFVKAKIMENTPVPPSGGTTPPGEYTGIGLPFTHDGAGEYY
WKTNKLSTDPNDWSHYINSWNLDLLEINGKDYTNVWVAQHQIAPSSDGYWYIHYKGSASS
AHMEMK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaataagagaaaaatgttggcttttatgattgctatagtattgatcctgtcatcattg
atgacttcgaccatcgtagtgaggaaaaccgaggcggctgcttcatctattgttgcaagt
cacgggatgctaaaggttgttggtaataaggtatgtgatgcttcgggaaagcctattcag
ttgaaaggtatgagtcttttttggagtcaatggtctactcctttttggaacgcagattta
gtgaataaccttgcatctacctggaatgctacgttaatacgtgctgctatgggagtagat
gagggaggttatatatcaaatcctcaggtagagaaacagaaagtaataacggtagtagat
gcggcaattaatgccggaatatatgttataatagactggcatagccatgatattcatact
tctgaagctgttgcattttttggcgagatggcacaaaggtacaagaacacacccaatgta
atttttgagatctttaatgaaccggattatgaatcgtgggcacaggtaaaaacttattct
acacaggttataaacacaatacgttcgaccggagcacaaaatcttattctggtaggttct
cctacgtggtcccaggatgtagatgtagctgccaatgatccgattactgggtttagtaac
attgcatacacccttcatttctatgctggaacgcataaacaatacttaagagataaagca
attactgccatgtcaaaggggcttgccctttttgtatccgaatggggaacttgcgatgcg
tcaggtaatggtaatttggatcttacggagtcgcaaagatggatagattttatgaatcaa
taccagataagctgggctaattggtctatgaacgataaagctgaaacagcatcggctctt
gttgtgggcgcgagtactacaggtccatggccggattctcagcttactgagtcgggtaaa
ttcgtaaaagccaaaataatggagaatacacctgtgccgccatcgggaggtacaacaccg
ccgggagaatatactggaatcggtttaccatttacccacgacggagcaggggaatattac
tggaagacaaataagctttccactgatcccaatgactggagccactatataaattcttgg
aatctcgatcttcttgagatcaacggaaaagactacaccaatgtatgggtggcacaacac
cagatagcaccttcatcagacggttactggtatattcattacaaagggagtgcttcctcg
gctcatatggagatgaaatag

DBGET integrated database retrieval system