KEGG   Mahella australiensis: Mahau_1115Help
Entry
Mahau_1115        CDS       T01494                                 

Definition
glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mas  Mahella australiensis
Brite
Enzymes [BR:mas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Mahau_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1156244..1157800
Genome map
AA seq 518 aa AA seqDB search
MSRKNALAFIVAIVMVVSLLCGPAISSNGAKAAPVTGEKFLGNIFSGSSEPLKFKQYWNQ
ITPENAGKWESVEGSRDSMNWGTLDAIYNYAKSNNMPFKFHTLVWGNQQPSWISSLSQTE
QRAEVEEWFAAVAGRYDDLDFIDVVNEPLHAPPSYRNALGGDGSTGWDWVITAFQLARQY
FPNSKLLINDYGIIADPSAAQRYVSLINLLKARGLVDGIGIQCHAFNMDTVSVSTMNQVL
TILDSTGLPIYVSELDMNGDDQTQLRRYQEKFPVLWEHSSVKGITVWGYIEGQTWQSEAY
LLRSNGTERPALTWLMGYVGSGSPPPSDTIPPAAPTGLTATAVSSSSINLDWADNTDSDL
AGYKVYRSTVSGFTPGSANFVKQVTTSAYTDTGLAADTTYYYKVTAVDTSGNESQPSAQA
SAKTQQGGGTTPPGEYTEITLPFTHDGAGEYYWKTNKLSTNPNDWSHYINSWNLDLLEIN
GKDYTNVWVAQHQIAPSSDGYWYIHCKGSFSYSHVEIR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggaagaatgcattggcttttatagttgcgatagtgatggttgtatcgttacta
tgtggcccggctataagttcaaatggagctaaggcggctcctgtcactggcgagaagttt
ttgggtaatatctttagcggtagttcggaaccactaaagttcaaacagtattggaaccag
ataacaccggagaacgcaggtaaatgggaatctgtggagggttctagagatagtatgaat
tggggtactctggacgccatatacaattacgcaaagagcaataacatgccatttaaattt
catactcttgtttggggaaatcaacaaccttcatggataagttcactttcacaaactgag
caacgtgcggaagtggaagagtggtttgctgctgtagcaggtcgttacgatgatctcgat
tttatagacgtagtgaatgagcctttacatgccccaccttcttataggaatgctttaggc
ggggacggaagtactggatgggattgggtaatcacggcctttcaattagcgcgtcaatat
ttcccgaacagtaaactgcttatcaacgattacggtattattgccgatcccagtgctgcg
cagagatatgtcagcctcatcaatttgcttaaggccagaggacttgtcgatgggataggt
attcagtgccatgcctttaatatggatacggtgagtgtgtctactatgaatcaggtgttg
actattcttgacagcaccggacttccgatatatgtatctgaactggatatgaatggcgat
gatcagacgcaactccgacgctatcaagaaaaatttcctgtgctatgggagcattcatca
gtaaagggtataactgtctggggatatatagaaggtcagacctggcagagtgaagcatac
cttctacgttccaatggcacagaacgaccggcgctgacatggctaatgggatatgttgga
agtggttctccgccaccatcggatacgataccgcctgcagcgcctacaggattgacggct
acagcagtaagttcgagcagcataaaccttgattgggcggataatacggacagcgacctg
gctggatataaagtatacagaagcacggtcagcggttttacacctggtagcgctaacttc
gtaaaacaggtaacgaccagcgcatacaccgatacgggcttggctgccgatacaacgtat
tactataaggtgactgcagtagataccagcggtaatgaatcacagccttcggcacaggcc
agcgcaaaaacacaacaaggtggaggtacaacaccgccgggagaatatactgagatcact
ttaccgtttacccacgacggagcgggggaatattactggaagacaaataagctttccact
aatcccaatgactggagccactatataaactcgtggaatctcgatcttcttgagatcaac
gggaaagactataccaatgtatgggtggcacaacaccagatagcaccatcgtctgatggt
tactggtatattcactgcaaggggagtttttcatactctcatgtagagattaggtaa

DBGET integrated database retrieval system