KEGG   Mahella australiensis: Mahau_1116Help
Entry
Mahau_1116        CDS       T01494                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mas  Mahella australiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mahau_1116
Enzymes [BR:mas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mahau_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158039..1159799
Genome map
AA seq 586 aa AA seqDB search
MSKKKILAFAIVMMLIVSLLCGTVVHLNETKAAPSIASTEMPGGRLTGVNWFGFETSNYV
VHGLWSRDYKSMLQQISDLGFNCIRIPWCNEMIGKYPSSIQINPDGVDAYTGKKGLNLDL
AGLSSLEVLDKIVEEAGRLNLKIILDNHSRAAGGYMNEQLWYTDSYSEQKWISDWVMLAE
RYKNNTNVVGFDLNNEPHGIATWGEGNSSTNWNEAASRCGQAILKVNPKALIMIEGVEKY
KGDSYWWGGNLSGVKDYPITGIPAGNLVYSPHDYGPTVFNQTWFTAPDFPNNMPKIWDDH
FWFIYKNGIAPIMLGEFGIKEEAAANPASGDYKWITSLMAYIGDKASWTFWCWNPNSGDT
GGILKDDWVSVNQAKYNILKPYLAPQFGGSSPPPSDTIPPAAPTGLTATAVSSSSINLDW
VDNTDSDLAGYKVYRSTTSDFTPGSANFVKQVTASAYTDTGLTADTTYYYKVTAVDTSGN
ESQPSAQASAKTQQGGTTPPSGEYTEISLPFTHDGAGEYYWKTNKLSTDPNDWSHYINSW
NVDLLEINGKDYANAWVAQHQIAPSSDGYWYIHYKGNVSSAHIEIK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaagaagatactggcttttgcgattgttatgatgttgatcgtgtcattatta
tgtggtactgtggtacacttgaatgaaactaaagcggctccttcgattgcatctacagag
atgcctggcggaagattaacgggtgttaattggtttggttttgaaaccagcaattatgtt
gttcatgggctatggtctcgggattataaatccatgttgcaacaaatttcagatcttggt
tttaattgtatacgtattccatggtgcaatgagatgatcggtaaatatcctagctcgatt
caaataaatccagacggagttgatgcatatacgggaaagaaaggcttgaatcttgatttg
gcaggattatcctcacttgaagtattggataaaattgttgaagaagctggaaggttgaat
cttaagattatattggataaccattccagggctgcgggcggttatatgaatgagcaactc
tggtataccgattcatactcggagcaaaaatggataagtgattgggtcatgttggctgaa
cgatataaaaataatacaaatgtggttggatttgatttaaataatgaaccgcatggcatt
gccacatggggtgagggaaactcttctaccaattggaacgaagcggctagcaggtgtggg
caagctatactgaaagtaaatccgaaagcccttattatgatagagggcgtagaaaagtat
aaaggagattcttattggtggggaggtaatttaagtggagtaaaagattaccctataaca
ggtattcctgcaggaaatctggtatattcgccgcatgattatggaccaactgtattcaat
caaacatggtttacagcacctgattttcctaataatatgccaaaaatatgggatgaccat
ttctggtttatatataaaaatggtatagctcctattatgctaggtgaattcggtataaaa
gaagaagctgctgcaaatccagcatctggtgactataaatggattacctcacttatggct
tacattggagataaagcatcatggactttttggtgctggaaccctaattccggagataca
ggtggaatattgaaggatgattgggttagtgtaaatcaggcaaaatataatatattaaag
ccatatttggctccacaatttggaggtagttctccgccaccatcggatacgataccgcct
gcagcgcctacaggattgacggccacagcagtaagttcgagcagcataaatcttgattgg
gtggataatacggacagcgacctggccggatataaagtatacagaagcacgaccagcgat
tttacaccaggtagtgccaacttcgtgaagcaggtaacggccagcgcttataccgatacg
ggcttaactgccgatacaacgtattactataaagtaacagcagtggataccagcggtaat
gaatcacaaccttcggcacaggccagtgcaaaaacgcagcaaggtggcactacaccgcca
tctggagaatataccgagataagcctaccgtttacccacgacggagcaggggaatattac
tggaagacaaataagctttccactgaccccaatgattggagccactatataaattcatgg
aatgtcgatcttcttgagattaacggaaaagactacgccaatgcatgggtagcacaacat
cagatagccccttcatcagacggttactggtatattcattacaaagggaatgtttcttca
gcgcatatagaaattaaatga

DBGET integrated database retrieval system