KEGG   Mahella australiensis: Mahau_1159Help
Entry
Mahau_1159        CDS       T01494                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mas  Mahella australiensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mahau_1159
Enzymes [BR:mas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mahau_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1200872..1201432
Genome map
AA seq 186 aa AA seqDB search
MVDQQKIEQAMRMMIEAIGEDPEREGLKDTPKRVARMYAELFSGIEENPRKYLEVWFNED
HEEMVLVKDIPFYSMCEHHFLPFVGKAHVAYIPTKGKVTGLSKLARVVESVARRPQLQER
LTSQIADILMECLDPQGVVVVIEAEHMCMSMRGVKKPGTTTVTSAVRGIFRRDAKSRAEA
FALIKG
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtagatcaacaaaagattgaacaagctatgcgcatgatgatagaagctataggcgaa
gaccctgaacgtgaggggcttaaggatactcccaaaagagtggccaggatgtatgccgaa
ttgttcagcggtatcgaagaaaatcctcgaaagtatctcgaagtatggttcaacgaggat
cacgaagaaatggtattggtaaaggatatacctttttattccatgtgcgaacatcatttt
ttgccgtttgttggcaaggcgcatgttgcttatataccgacaaaaggtaaagtaacgggt
ttgagcaaactggcaagggtagtggagtcggtggctcgcaggccgcagcttcaggaacgc
cttacaagtcagatagctgacatattaatggagtgtctggatcctcaaggcgtagttgtc
gtgatagaagctgagcatatgtgcatgagtatgaggggcgtaaagaagccgggtaccacc
accgtaacctcggcggtgagaggcatattcaggcgagatgccaaatcgagagccgaggct
tttgctttgatcaagggatag

DBGET integrated database retrieval system