KEGG   Mahella australiensis: Mahau_1163Help
Entry
Mahau_1163        CDS       T01494                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mas  Mahella australiensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mas00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203120..1203617
Genome map
AA seq 165 aa AA seqDB search
MSAKVNRVYLALGSNIGDRDRYIREAIDMLNGHEAIKIVKVSPTYNTAPVGYTDQADFLN
AAVAIDTTLSPRELLVVCLDIEKRLGRVRTIRWGPRTIDIDIIFYDDLIINDDLLTVPHP
RMHERRFVLQPLCDIAQNAVHPIYKKTVEQMYDEWKTKGDINFNV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaaggttaacagggtttatctggctcttggttctaatatcggcgatagggat
aggtatataagagaggctatagatatgctgaacgggcatgaagctataaagatcgtcaaa
gtatcgccgacttacaatacagccccagtgggttataccgatcaagccgactttttaaat
gcggctgtagctatcgatacgacgctttctccgcgcgaattgctggttgtctgccttgat
atagaaaagcgattggggcgtgtccgcactatacgctgggggccgcgtacaatagatata
gatataatattttacgatgaccttataataaacgatgatttactgacagtgcctcatccc
cgtatgcacgagagaaggtttgtgttgcaacctttatgcgatatagcgcagaatgcggtg
catcctatatataaaaaaactgttgaacagatgtatgatgaatggaaaacgaaaggggat
ataaattttaatgtatag

DBGET integrated database retrieval system