KEGG   Mahella australiensis: Mahau_1239Help
Entry
Mahau_1239        CDS       T01494                                 

Definition
(GenBank) uroporphyrinogen-III C-methyltransferase; uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mas  Mahella australiensis
Pathway
mas00860  Porphyrin and chlorophyll metabolism
mas01100  Metabolic pathways
mas01110  Biosynthesis of secondary metabolites
mas01120  Microbial metabolism in diverse environments
Module
mas_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mahau_1239
Enzymes [BR:mas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Mahau_1239
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mahau_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AEE96433
UniProt: F3ZW53
Position
1293648..1295174
Genome map
AA seq 508 aa AA seqDB search
MMGKVYLIGAGPGDAGLITQKAIECLKSADVVIYDRLVNQKLLTYADKSARLIYAGKQPG
KHAMIQQDINRLLVDEAMAGHTVARLKGGDPFVFGRSGEEAMALRRHGLPYEVVPGITSA
IAVPTYAGIPVTYRGLASSVHIITGHEGASKQKSDIDWDVLAKLDGTLIFLMGMERLSDI
CSQLILYGKAERTPAAVIEQGTTARQRTIVGTLADISQRAAQEEIRSPSVIVIGDVVSLR
QQLRWYEHLPLCGKVIMVTRADGQREDLARGLERLGAQVEHFPVISIKPPDDYGPLDEAI
EFISQYKWLIFTSANGVESFFDRLLYHGMDSRYIAGIKVGAIGSGTYATLKQHGVIADYM
PESFSTDDLASGLKEQITLGMRILLPCSDIAGLNIKQTLECAGAVVDMVTAYRTVPNAQQ
SQRLIDLLGDHYIDAITFTSSSTVHNFVNILGVGNVSLLDGVKLASIGPVTSAALRQYGL
KVDMQADVYTIDGLIGALKEDFCNGHTI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcaaggtatatcttataggggcgggtcccggggatgcaggccttataacccaa
aaggccatagaatgcttgaaatcggcagatgtagtgatatatgaccgattggtaaatcag
aaacttttaacctatgcggacaaatcggcaaggctcatatacgccggcaaacaacccgga
aagcatgccatgatacagcaagacataaatcgtctgttagtggatgaggctatggccggg
catacggtagctcgcttaaagggaggtgatccctttgtattcggcaggagtggtgaagaa
gctatggcattacggcgccacggtttaccgtatgaagtagtgccgggtataacatcggct
atagccgtgccaacttatgccggcataccggttacatatcgagggttggcatcgtcggtg
cacattattaccgggcatgagggcgcttccaaacaaaagtccgatatcgattgggatgtg
ctggctaaattggacggaacgttaatctttctgatgggcatggagcgcttgagcgatata
tgtagccagctcattctatacggcaaggctgaacggacgcctgcggccgttatagaacaa
ggcaccacagcacggcaaaggacgattgtagggacattggcagatataagtcaaagagcc
gcacaagaagaaatacgctcgccatctgtaatagtaataggcgatgtagtatcgctgcgc
cagcaattgaggtggtatgagcatctgcctctatgcggtaaggttataatggtgacgcga
gccgacggccaacgagaagatttggcacgagggttggaacgattgggggctcaagtcgag
cattttccggtcatatcgataaagccgcctgatgattatgggccgctggatgaagccata
gaattcatatcacaatataaatggcttatatttaccagtgccaacggtgtggaatctttc
tttgacaggctgttgtaccacggcatggatagccgctacattgccggaataaaagtgggc
gcgataggcagcggcacgtatgctactttaaaacagcatggtgttatagcggattatatg
ccggagagttttagtacagatgatttggcgtctggactgaaagaacagataacactcggt
atgcgcatattgctgccgtgctcggacatagccggccttaatataaagcaaacgttagag
tgtgcgggtgctgtagtagatatggtcacagcctatcgcacggtgcccaatgctcaacaa
agtcagcgtttgatagatttacttggcgatcattatatagatgcgataacttttacgagt
tcgtccactgtccataacttcgtaaatatattgggcgtgggcaatgtatcattgctagac
ggcgttaaattggcctccatagggccggttacttcggctgctttgcgacaatacgggctt
aaagtcgatatgcaggccgacgtttatactatagatggattgataggagcgttaaaggag
gatttttgtaatggacatactatatag

DBGET integrated database retrieval system