KEGG   Mahella australiensis: Mahau_1240Help
Entry
Mahau_1240        CDS       T01494                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mas  Mahella australiensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mahau_1240
Enzymes [BR:mas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mahau_1240
Exosome [BR:mas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mahau_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295158..1296135
Genome map
AA seq 325 aa AA seqDB search
MDILYRPRRLRQNDAIRDLVRETELNVHDLIYPIFVMHGMNTQEGIQSMPGIYRYSVDRL
MEELEDIVKLGIPGILIFGLPEYKDAVGSEAYADDGVVQEAVKAIKRRFPTLLVITDVCL
CEYTDHGHCGIVKDGIVDNDASAELIARTALSHARAGADIVAPSDMMDGRIGAVRKALDQ
NGYQHVSIMAYSAKYASAFYGPFREAAQSAPQFGDRRSYQMDPANAREALREVKLDIQEG
ADIVMVKPALSYLDVIHAVRQRFDVPLAAYNVSGEYAMIRAASANGWMDEHNAALEALTS
IKRAGADIIITYFAKDAAKWLDTIL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggacatactatataggccgagacgtttgaggcaaaacgatgctataagggatttggtg
cgggaaaccgagctgaacgttcacgatcttatatacccaatctttgtcatgcatggtatg
aacacgcaagagggcatacagtccatgccgggcatatatcgttattctgtcgataggctg
atggaagagttagaagatatcgtaaagctcggcattcccggtatccttatattcggtttg
ccggaatacaaggacgccgttggtagcgaggcttatgccgacgatggtgtagtgcaggag
gctgtaaaagccataaaaaggcgattcccgacattgttggtcattaccgatgtgtgtttg
tgcgaatatacagaccatggccattgcggcattgtaaaggacggcatagtggataacgat
gcatcggcagagctgatagcccggacggcgctatcgcatgcgcgggccggcgccgatata
gtagcgccgtcggatatgatggatgggcgcataggtgctgtaagaaaggctttggatcag
aatggttatcagcatgtatctatcatggcctacagcgccaaatatgcatcggctttttat
gggccatttcgcgaagcggcccaatcggcgccgcaattcggcgacaggcgctcgtaccag
atggaccctgccaatgccagagaagcgctgcgcgaggtaaaattggacattcaagaaggg
gccgatatagtcatggtcaaaccagcattaagctatttggatgttatacatgccgtaagg
cagcgctttgatgtaccgttggcggcgtacaatgttagcggcgaatatgccatgataagg
gctgcctcagctaatggctggatggatgagcataatgcggcattggaggcattgacttcc
ataaagcgtgcaggcgcggatataatcataacttatttcgcaaaggatgcggccaaatgg
ctcgatactattctgtaa

DBGET integrated database retrieval system