KEGG   Mahella australiensis: Mahau_1256Help
Entry
Mahau_1256        CDS       T01494                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17 6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mas  Mahella australiensis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mas00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mahau_1256
Enzymes [BR:mas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Mahau_1256
Amino acid related enzymes [BR:mas01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Mahau_1256
Transfer RNA biogenesis [BR:mas03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mahau_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1311584..1313050
Genome map
AA seq 488 aa AA seqDB search
MNGIRVRFAPSPTGPIHIGNMRTALFNYLFAKHEGKADFILRIEDTDATRSTVEYEKYIY
KELEWLGIEWDEGPDKGGPVGPYRQSQRLDIYQRYLQKLIDEGFVYRCYCTPEELEVDKE
QAVKAGDIPRYSGKCRHLSDEEIRRFEAEGRPSVIRFIVPDHEMIAFDDLIKGHIEIDSH
TLGGDMIIFRSDNMPTYNFAVVIDDHLMDITHVIRGDDHVANTPKQLLIYKALGFTPPLF
AHTAMILGPDRTKLSKRHGDNYIGQYRHKGYLPEALFNFLALLGWSPEDEREIMSKDEII
SAFSLNRASRSPAVFDIDKLNWMNGIYIRQSPPGRIAALAVPHLKAAGLIDDNVDMRWLE
KAVASVQEGISYVAEIVEPLRIYFGNVVEPENDEAAEVLKAQGVYGLLQRFKEIVEQAQN
IDEAFAKEVFNQLKNDTGLKGKSLFMPIRVALTGRCHGPEMVTVIPLLGRDLILSRLEHI
LSRLGEDI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtatacgagtgagatttgcacccagtcctactgggccgatacacataggcaat
atgcgtacagcgctgtttaactatctatttgccaaacatgagggcaaagcagacttcata
ttgcgcatagaagataccgatgccacaagatccactgttgaatatgagaaatatatatat
aaagaactggaatggctggggatagagtgggacgagggaccggataaaggaggtcctgtt
gggccatacagacaaagccaacgtttggatatttatcagcgatatcttcagaagcttata
gatgaaggctttgtttatcgctgctattgtacacccgaagaattagaggtcgataaggaa
caagcggtaaaggctggcgatataccccgatattccggaaaatgtcgtcatttatccgac
gaagaaataaggcgcttcgaagccgaaggtaggccgtcggttataagattcatagtgccc
gatcacgaaatgatcgcattcgatgaccttataaaaggccatatagagattgatagtcat
acgttgggtggggatatgataatattccgctctgataatatgcccacatacaatttcgct
gtggtcatagatgatcatttaatggatataacccatgttattcgcggagatgatcacgtg
gctaatacgcctaaacagttgctaatatataaagcattgggttttactccgcctttattt
gctcatacagctatgatactgggaccggatcgcactaaattgagcaagcgtcacggagat
aattatataggccaatatcggcacaaaggttatctacctgaggctttattcaattttctt
gccttgctaggttggtctccggaagatgagcgggaaatcatgagtaaagatgaaattata
tcggcgttttcattgaatagagcatctcgttcacccgccgtatttgatatagataagtta
aactggatgaacggcatatacataaggcaaagcccacctggtcgcatagcagctctagct
gttccgcatcttaaggcagccggcttaatagatgataatgtggatatgcgatggttggag
aaagcagtagccagcgtacaagagggtataagctatgtggcagaaatagtagagcctctg
agaatatatttcggtaatgtcgtagagccggaaaatgatgaagctgcagaagttttgaag
gctcaaggcgtatatggcttgcttcaaaggtttaaagagattgtcgagcaggcccagaat
atagatgaagcatttgctaaggaagtttttaatcagctaaaaaatgacacaggacttaaa
ggcaaaagcctttttatgcctatacgtgtggctttgaccggcaggtgtcatgggccggaa
atggtgactgtaataccattattagggcgcgatcttatattatcgcgtttagaacatata
ttatcgcgattaggtgaagatatataa

DBGET integrated database retrieval system